KEGG   Eggerthella lenta: Elen_0567Help
Entry
Elen_0567         CDS       T00984                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ele  Eggerthella lenta
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Elen_0567
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Elen_0567
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Elen_0567
Enzymes [BR:ele01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Elen_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(719657..721225)
Genome map
AA seq 522 aa AA seqDB search
MKVQDMAQNLYSDTRGQSERPVTFTEAVIDGLAAGGGLYVPERIPELSLDEIGALAELPY
AQRAARIYRAFDVDLPAETVEALMAQAYGDNFDDERICPITSLSADTHVLELWHGPTSAF
KDMALQCLPRFFSASAAQLREQGKLDHDFLILVATSGDTGKAALEGFRDVDGVSIGVMYP
DGGVSDIQFKQMATQRGRNVQVWGVRGNFDDCQTGAKNVFGDEAFAKKLQDEHRIALSSA
NSINWGRLMPQIVYYVSAYAQLAADGKLNLGDELDVCVPTGNFGNILAAYYAKRMGVPLG
MLYCASNENRVLTDFINTGTYDISERPFVLTPSPSMDILVSSNLERQLFELTGRDAAAIA
GWMADLRGQRRFRVDEETFARVRELFASDSIDNATCLDTIKRVFEQHGYLLDPHTAVAYQ
TAENLRGENPVLIASTAHWAKFGDNVYRALHGIEPGAPLPDDVAALSGCKLNELIARETG
VDDIPHGLAELDALPIRFDEVIDGGTNDIEAAALRFLEHLDD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgcaggacatggctcaaaacctctactccgacacgcgcgggcaaagcgagcgc
cccgtcacctttacggaagccgtcatcgacggcctggccgcgggcggcggcttgtacgtg
cccgaacgcatccccgagctttccctcgacgagatcggagcgctggccgagctgccgtac
gcccagcgcgcggcgcgcatctatcgggcgttcgacgtggatctgcccgccgaaaccgtc
gaagcgcttatggcccaggcttacggcgacaacttcgacgacgagcgcatctgccccatc
acgtcgctttcggccgacacccacgtgctggagctatggcacggccccacgagcgcgttc
aaggacatggcgctgcagtgcctgccgcgtttcttctccgcaagcgccgcccagctgcgc
gagcagggcaagctcgaccacgacttcctcatcctggtagccacctcgggagacacgggc
aaagccgcgctcgagggcttccgcgacgtggacggcgtgtccatcggcgtcatgtacccc
gacggcggcgtgagcgacatccagttcaagcagatggccacgcagcgcgggcgcaacgtg
caggtatggggcgtgcgcggaaacttcgacgactgccagacgggcgcgaaaaacgtgttc
ggcgacgaggcctttgcgaagaagctgcaggacgagcaccgcatcgctctttccagcgcg
aactccatcaactgggggcgcctcatgccccagatcgtgtactacgtgtcggcctacgcg
cagctggcggccgacggcaaactgaacctgggcgacgagctggacgtatgcgtgcccacg
ggcaacttcggcaacatcctggccgcctactacgccaagcgcatgggcgtgccgctgggc
atgctgtactgcgccagcaacgagaaccgcgtgctcaccgacttcatcaacacgggcacc
tacgacatatccgagcgccccttcgtgctgacgccctcgccgtccatggacatcctcgtt
tcgtcgaacctggagcgtcagctgttcgagctcacgggacgcgacgccgccgccatagcc
ggctggatggccgacctgcgcgggcagcgccgcttccgcgtggacgaagagaccttcgcc
cgcgtgcgggagctgttcgcgtcggactccatcgacaacgccacgtgcctggacaccatc
aagcgcgtgttcgagcagcacggctacctgttggacccgcacacggccgtggcctaccag
accgccgagaaccttcggggcgagaaccccgtgctcatcgcgagcacggcgcactgggcc
aagttcggcgacaacgtgtaccgcgcgctgcacggcatcgagcctggcgcgccgctgccc
gacgacgtggccgcgctgtcgggctgcaagctgaacgagctgatcgcgcgcgagacgggc
gtcgacgacatcccccacggcctggctgagctggacgcgcttcccatccgcttcgacgag
gtcatcgacggcggcacgaacgacatcgaggcggcggcactgcgtttcctcgagcacctg
gacgactga

DBGET integrated database retrieval system