KEGG   Eggerthella lenta: Elen_0706Help
Entry
Elen_0706         CDS       T00984                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Elen_0706
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_0706
   00620 Pyruvate metabolism
    Elen_0706
   00640 Propanoate metabolism
    Elen_0706
  Energy metabolism
   00680 Methane metabolism
    Elen_0706
Enzymes [BR:ele01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Elen_0706
Lipid biosynthesis proteins [BR:ele01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Elen_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(884265..886256)
Genome map
AA seq 663 aa AA seqDB search
MNRNTRNAFVRQMLQNETSIEPSPEFSYNALIKSRQDYDAMYSRSIADPEAFWADMATEH
LDWFKPWDAVEEYDFDSDEPFVRYFRGGELNASCNCIDRHLNGPRRNKAALIWQGEPTEE
VDVYTYQRLHREVCKAANMLRRLGVRKGDRVVLYMPMVPQLAISMLACARIGAIHCVVFS
GLSAESLKDRIVDSGATVVITSNYGYRSGKILRLKEICDKALDMCPQVESCVVVRRIEKR
TAMKAGRDFWWDDVLAPEAPQCEPERMEANDPLFILYTSGSTAKPKGILHGTGGYLLYAT
LTSKYVFDLKEHDIFWCTADAGWITGHSYLVYGPLSNGTTSLMFEGVPNFPKPDRFWEIV
EKFGVNILYTAPTAVRSMMKDGDRWVNEHDISTLRLLGSVGEPITSKAWMWYYSTVGHSM
CPIVDTWWQTETGGIMITSIPGAVDMKPGSAALPFFGIEPRVIGADGAEADAGERGSLVL
TRPWPGMMLGVYGNAKAHKDVYFPTPGYYLTGDGAYRDEDGYFWITGRIDDVMNVSGHRI
GTAEVESALVSYSQVAEAAVVGYPHPVKGEGIYAYITVKEGTVIDADLRDRLFVHVREII
GPIATPDVIHFANALPKTRSGKIMRRILRKIAAQETEDLCDISTLSEPSVVHELIQETKR
MSA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaacacccgcaacgccttcgtcagacaaatgctccaaaacgaaacgtccatc
gagccctcgcccgaattcagctacaacgccctcatcaaaagccggcaggactacgacgcc
atgtacagccgttccatcgccgatcctgaggctttttgggccgatatggccaccgagcac
cttgactggttcaaaccgtgggacgccgtcgaggaatacgatttcgattcggatgagccg
ttcgtgcgctacttccgcggcggggagcttaacgcatcttgcaactgcatcgatcgccac
ctgaacgggccgcgcaggaacaaagccgcgctcatctggcagggcgagcccaccgaagaa
gtggacgtctacacttaccagcgtctgcatcgcgaggtgtgcaaggcggcgaacatgctc
cgccgcctcggcgtgcgaaagggcgatcgcgtggtgctgtacatgcccatggtcccccaa
ctcgcgatcagcatgctggcgtgcgctcgcatcggcgctatccactgcgtggtgttcagc
ggcctgagcgccgaatcgctgaaggatcgcatcgtcgactcgggtgccacggtggtcatc
acgtcaaactacggataccgttcgggcaagatcctgagactcaaggaaatctgcgataaa
gcccttgacatgtgcccccaggtcgagagctgcgtcgtcgtacgccgcatcgagaaacgc
acagccatgaaggcggggcgcgatttctggtgggacgacgtgcttgctcccgaggcgccc
caatgcgagccggagcggatggaagcgaacgatcccctgttcatcctctacacgagcggc
agcacggcgaaaccgaagggcatcctgcatggcaccggcggctatctgctttacgccacc
ctcacctcgaagtacgtgttcgacctcaaagagcatgacattttctggtgcacggccgac
gccggctggatcaccggtcattcctacctcgtgtacgggccgttgtcgaacggaacgacg
tcgctcatgttcgaaggcgtgcccaacttccccaagcccgaccgtttctgggagatcgtt
gagaagttcggcgtcaacatcctgtacacggccccgaccgcagtgcgctccatgatgaaa
gacggcgaccgctgggtgaacgagcacgacatctcgaccttgcggctgctcggctcggta
ggcgagcccatcacctcgaaggcttggatgtggtactactccaccgtcggtcacagcatg
tgccccatcgtcgacacgtggtggcaaaccgagacgggcggcatcatgatcacctcgata
cccggcgcagtggacatgaagccaggatcggcggcgctaccgttcttcggcatagaaccg
agggtcatcggagcggacggagccgaggccgatgccggcgagcgcgggagcctcgtgctg
acgaggccatggccgggcatgatgctgggcgtgtacggcaacgcgaaggctcacaaagac
gtgtacttccccacccccggctactacctcacgggcgatggcgcctatcgagacgaggat
ggctacttctggatcacgggtcgcatcgacgacgtgatgaacgtgtcgggccaccgcatc
ggcacggccgaagtcgaaagcgcgctcgtctcgtactcgcaggtcgcagaagcagccgtc
gtagggtacccgcatccggtgaagggcgagggcatctatgcctacatcaccgtcaaagag
ggaacggtcatcgacgccgacctgcgcgaccgcctgttcgtgcacgtacgggagatcatc
gggcccatcgccacgcccgatgtcatccatttcgccaacgcgctgccgaaaacgcgcagc
ggtaaaatcatgagacgcatcctgcggaaaatcgccgcgcaggagacggaggatctgtgc
gacatctccacgctgtccgagccttccgtggtgcacgaactcatccaagagacgaagcgc
atgagcgcctag

DBGET integrated database retrieval system