KEGG   Eggerthella lenta: Elen_0929Help
Entry
Elen_0929         CDS       T00984                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ele  Eggerthella lenta
Brite
Enzymes [BR:ele01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Elen_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1132205..1135387
Genome map
AA seq 1060 aa AA seqDB search
MKFKFKVQRYQTDAADAVTSVFEGQPNQGASVYLRDLGRKPKCAQGEIDFGDESTEGYAN
APVALSGADILANVRAVQRRNQIPESEELFCSMGACQLDVEMETGTGKTYVYTKTMLELN
RLYGWCKFIVVVPSVAIREGVAKSLENTQEHFFSQYHKKIRFFIYDSDNLTELDAYSQSS
DVNCMVINMQAFNASMKEGAKNKAARIIFDERDEFSSRRPIDVIAANRPIVICDEPQKMG
KKGGATQKGIARFNPLFVLNYSATHKEKHDLVYALDALDAYNQKLVKRIEVKGFALKNMR
GTDGYLYLRDIVVSKNRAPEAVIEFKCMGSGGKVRKKTARFGEGDSIYGASGSTKLEAYR
GYTIASGNDGVVPPQDGRPGYVRFLDGSIGDDGRVYIGEVYGDSAADDMQRIQIRETILS
HLQKEEALFRRGIKCLSLFFIDQVAKYRDLSGNGETVGYGKIFEEEYEAIVSDRLEHPTQ
DDILDPSYAEYLGRFEACSVHSGYFSVDKKGNAVESKAERKAERDDGIGINDDDAKRGYD
LILRDKERLLSFDEPVRFIFSHSALREGWDNPNIFQICTLKESGSETSKRQEVGRGMRLA
VDQDGNRQDAALLGPDEVHRVNLLTVIASESYETFVRDLQTDISKSLRDRPKKVEMDLFS
GRDVVLDGETVSFTEDESRRVYKTLYKCDLIDDDDKPTAEFRKAVEDGTFVEYFVAKLPE
EIADAAHAKAVEALVKSVYDAHALDGMIGRAQEKISENTLTDNFARREFKELWARINRKH
AYTVSFSDDELRRKSIERINCDLRVSRLQYTLTVGGQKSRATRDEVQGGSSFGRTQTETR
NVDAGTASVGVTYDLVGEVAQAAAITRRSAAAILAGIDANVFGLYRVNPEEFIKKTAALI
VSEKATMVVEHISYHEIDDVYDEAIFTERMPDNASKAYEAKKNIQRFVFPDSDGERRFAE
DMDAAAEVAVYAKLPRTFQIPTPVGNYAPDWAIAFKEGSVRHVFFVAETKGTVDTLELSG
VENAKIACAKKLFNEMSTGDVRYHNVATYEDLLEVMGRMG
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaagttcaaagtacaacggtaccaaaccgacgccgcagatgcggtgacctcg
gtcttcgaggggcagcccaaccagggcgcctccgtctacctgcgcgatctgggccgcaag
cccaagtgtgcgcagggcgagatcgacttcggcgacgagagcaccgagggctatgccaat
gcgcccgtcgcgctttcgggcgctgacatactggcaaacgtgcgagcggtgcagcgacgc
aaccagatccccgagtcggaggagcttttctgcagtatgggagcctgccagctggacgtc
gagatggagacgggcaccggcaagacatacgtctacaccaagacgatgctcgagctcaac
cgcctgtacggctggtgcaagttcatcgtggtggtgccatcggtcgccatccgcgagggt
gtggccaagagcctggagaacacccaggagcacttcttctcccaataccacaagaagatc
aggttcttcatatacgactcggacaacctgaccgaactggatgcgtattcccagtcgagc
gacgtcaactgcatggtcatcaacatgcaggcgttcaacgcgtcgatgaaggagggcgcc
aagaacaaggcggcgcgcatcatcttcgacgagcgcgacgagttcagcagccgtaggccc
atcgacgtcatagcggcgaaccgccccattgtcatctgcgatgagccccagaagatggga
aagaaggggggcgcgacccagaagggcatcgcccgcttcaacccgctgttcgtgctgaac
tactcggcaactcacaaggagaagcacgacctggtgtatgccttggacgccttggacgcc
tacaaccagaaactcgtcaagcgcatcgaggtgaagggcttcgccctaaagaacatgcgc
ggaaccgacggctacctgtacctgcgcgacatcgtggtatccaagaatcgcgcccccgag
gccgttatcgagttcaagtgcatggggtctggcggcaaggtgcgcaagaagaccgcacgc
tttggcgagggcgacagcatctacggcgccagcggttcgacgaagctcgaagcgtaccgc
ggctacaccatcgcgagcggcaacgacggcgtggtcccgccccaggatgggcgcccaggc
tacgtgcgcttcctggacggctctatcggggacgacgggcgcgtctacatcggcgaggtc
tacggcgactccgccgccgacgacatgcagcgcatacagattcgcgagacgatcctgagc
cacttgcaaaaggaggaggcgcttttccgccgcggcatcaagtgcctgagtcttttcttc
atcgaccaggtagcgaagtaccgcgacctctccggaaacggcgaaacagtgggctacggt
aagatcttcgaggaggagtacgaggccatcgtctccgacaggctggagcacccgacgcag
gatgacatcctcgacccctcgtatgcggagtacctcgggcgattcgaggcatgctcagtg
cactccggatacttctcggtggacaagaagggcaacgccgtcgagtcgaaggccgagagg
aaggcggagcgcgatgacggcatcggcatcaacgacgacgacgcgaaacgcggctacgac
ctgatcctgcgcgataaggagcgcctgctttcgttcgatgagccggtgcgcttcatcttc
agccactcggcgctgcgcgagggctgggacaacccgaacatcttccagatctgcacactc
aaagaatccggctctgagacgagcaagcgccaggaggtcggccgcggcatgcgcttggcg
gtcgatcaagacggcaaccgccaggacgcggcgctgctgggacccgacgaggtgcaccgc
gtgaacttgctcaccgtgatcgcgtcggagagctacgagacgttcgtgagggatttgcag
acagatataagcaagagcctgcgcgatcgtccgaagaaggtggagatggacctgttcagc
ggtcgcgacgtcgtgctcgacggcgagacggtctccttcaccgaggacgagtcgaggcgc
gtatacaaaaccctctacaagtgcgacctcatcgatgacgacgacaagccgaccgccgag
ttccgcaaggccgtggaggacggcaccttcgtggagtacttcgtcgcgaagctgcccgag
gaaatcgccgacgctgcccacgccaaggcggtcgaggcgctggtgaagagcgtctacgac
gcgcacgcgctcgacggcatgatcgggcgcgcccaggagaagatctccgagaacacgctg
accgacaacttcgcaagacgcgagttcaaggaactgtgggcgcgcatcaaccgaaagcac
gcctacacggtgagcttctcggacgacgagttgaggcgcaagtcgatagagcgtatcaac
tgtgacctgcgcgtgagcaggctgcagtacaccttgacggtcggcgggcaaaagtcacgg
gcaacgcgcgacgaggtgcagggcggctcgtcgttcggccgcacgcagaccgagactcgc
aacgtcgacgccggaaccgcgtccgtgggcgtgacctacgacctcgtgggcgaggtggcg
caggccgctgctatcacgcgcaggagcgccgcggcgattctcgccggcatcgatgccaac
gtgttcgggctctaccgcgtgaatcccgaggagttcatcaagaagacggcggcgctcatc
gtgtcggagaaggcgacgatggtggtggagcacatcagctaccacgagatcgacgacgtc
tacgatgaggctatcttcactgagcgcatgcccgacaacgcgagcaaggcgtacgaggcc
aagaagaacatccagcgcttcgtgtttcccgactccgacggcgagcgcaggttcgctgag
gacatggacgccgccgccgaggtagcggtctatgccaagctgccgcgcacgttccagatt
cccacgccggtgggcaactacgccccagactgggccatcgccttcaaggaaggcagcgtg
cgccatgtgttcttcgtcgccgagaccaagggcaccgtggacacgctggagctctccggt
gtggagaacgccaagatcgcctgcgccaagaagcttttcaacgagatgagcacgggcgac
gtgcgctaccacaacgtggcgacgtacgaggacctgctcgaggtgatgggcaggatgggc
tag

DBGET integrated database retrieval system