KEGG   Eggerthella lenta: Elen_0973Help
Entry
Elen_0973         CDS       T00984                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ele  Eggerthella lenta
Pathway
ele03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ele00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Elen_0973
Enzymes [BR:ele01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Elen_0973
DNA repair and recombination proteins [BR:ele03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Elen_0973
    RecFOR pathway proteins
     Elen_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N HHH HHH_2 5_3_exonuc Transposase_20 HHH_8 RuvA_C
Motif
Other DBs
NCBI-ProteinID: ACV54945
JGI: Elen_0973
UniProt: C8WP56
Position
1180363..1180956
Genome map
AA seq 197 aa AA seqDB search
MIAFLKGVLAAKTATTAYIEVNGIGYAVGMSQAGLSKLPEAGAAVEVHTFLQVRDDGLAL
FGFLTLEEKALFERLIGVGGVGPKVALAALSAFSPAGLVAAVQAQDVAAVQRIPGVGKKT
ASRIILELKGSFDEGLAGLFDEAAPVVASAANLAGTREALLSMGFTSEEADVALKGAPEG
AAESVLLQYALKRLGTN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtttctcaaaggggtgctggccgcgaagaccgccacgaccgcctacatcgag
gtgaacggcatcggctacgccgtgggcatgtcccaggccggcctgtcgaagctgcccgag
gcgggcgccgccgtggaggtgcacacgttcctccaggtgcgcgacgacggcctcgcgctg
ttcggcttcctcacgctggaagagaaagcgctgttcgagcggcttatcggcgtgggcggt
gtggggccgaaggtggcgctcgccgcgctgtcggcgttctcgcccgcgggcctcgtggcc
gccgtgcaggcgcaggacgtggccgcggtgcagcgcatccccggcgtgggcaagaagacg
gcgtcgcgcatcatcctcgagctgaagggctcgttcgacgagggccttgcgggcctgttc
gatgaggcggcgcccgtggtcgcgtcggcggcgaacctcgcgggcacgcgggaggcgctg
ctgtcgatgggcttcacgtccgaggaggccgacgtcgcgctcaagggcgctcccgagggc
gcggccgaaagcgtgctgctacaatatgcgctgaagcgactgggaacgaactag

DBGET integrated database retrieval system