KEGG   Eggerthella lenta: Elen_1079Help
Entry
Elen_1079         CDS       T00984                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ele  Eggerthella lenta
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Elen_1079
  Amino acid metabolism
   00340 Histidine metabolism
    Elen_1079
Enzymes [BR:ele01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Elen_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1304748..1306106
Genome map
AA seq 452 aa AA seqDB search
MRRIILQPGEQFTNAHLKRTGAFNAQALTAATAIIEGVRERGDEALRAYTEQFDGVRVEE
FRVSQAAIAEAIVNVDDKTARALRQAAAQIRDFHERQKQQSWFTVREDGALVGSKVEPLE
SVGIYVPGGRALYPSSVLMNALPAAVAGVKRIVCVTPPTADGTLDPAILEACRISGVTEI
YAVGGAQAIAALAYGTESIAPVAKITGPGNAYVAAAKKVVSGDVGIDMIAGPSEVCVVAD
STADPALVAIDLMAQAEHDPLAACYLVTFDAAYADEVERMVERHLKSSTRAEITAASLAD
QGLIVVCDSMPQAIEAVNAIAPEHLELHVDHAFDLLGAIRNAGAIFLGAWTPEAVGDYAA
GPNHTLPTGGTARYASPLSVDEFVKKSSVIQYSSQALARDADMVTTIARHEGLWAHAMSV
EMRKNLLDTGNVYGIEGGDGAGRAAGDGGADA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcatcatcttgcaacctggcgagcagttcaccaacgcccacctcaagcgcacc
ggcgcgttcaacgcccaggccctgacggcggccaccgccatcatcgagggcgtgcgcgag
cgcggcgacgaggccctgcgcgcctacaccgagcagttcgacggcgtgcgcgtggaggag
ttccgcgtgtcgcaggcggctatcgcagaagccatcgtgaacgtcgacgacaagacggcg
cgcgccctgcgtcaggccgccgcacagatccgcgacttccacgagcgccagaagcagcag
agctggttcaccgtgcgcgaggacggcgcgctcgtgggctcgaaggtggagccgctggaa
tccgtgggcatctacgtgccgggcgggcgcgcgctgtacccgtcgtcggtgctgatgaac
gcgctgccggccgccgtggccggcgtgaagcgcatcgtatgcgtgacgccgccgacggcc
gacggaacgctggatccggccattttggaggcgtgccgcatctcgggcgtcaccgaaatc
tacgcggtgggcggcgcgcaggccatcgccgcgctggcgtacggcaccgagtccatcgcg
cccgtggccaagatcaccggacccggcaacgcctacgtggcggcggcgaagaaggtggtg
tcgggcgatgtgggcatcgacatgatcgccggcccgtccgaggtgtgcgtcgtggccgac
tccacggccgatccggcgctcgtggccatcgacctcatggcgcaggccgagcacgacccg
ctggccgcctgctacctggttacgttcgatgcggcctacgccgacgaggtggagcgcatg
gttgagcgccacctcaagtcgtccacacgcgccgagatcacggcggcatcgctggccgac
cagggcctcatcgtcgtgtgcgacagcatgccgcaagccatcgaggccgtgaacgccatc
gcgcccgaacacctcgagctgcacgtcgaccacgccttcgacctcttgggcgccatccgc
aacgcgggcgccatcttcctgggcgcctggacgcccgaggccgtgggcgactacgccgcc
ggcccgaaccacacgctgcccacgggcggcacggcgcgctacgcctcgccgttgtcggtg
gacgagttcgtgaagaagtcgagcgtcatccagtattcgtcgcaggcgctcgcccgcgat
gccgacatggtaaccaccatcgcgcgccacgagggcctgtgggcgcacgccatgagcgtg
gagatgcgcaagaacctgctcgacacgggcaacgtgtatgggatcgagggcggcgacgga
gcgggccgcgcggccggagacgggggtgccgatgcgtag

DBGET integrated database retrieval system