KEGG   Eggerthella lenta: Elen_1105Help
Entry
Elen_1105         CDS       T00984                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ele  Eggerthella lenta
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Elen_1105
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Elen_1105
Enzymes [BR:ele01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Elen_1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1336616..1337905
Genome map
AA seq 429 aa AA seqDB search
MAEEIIIVQGNNTLAGDVAVSGAKNSALKLIAAALLGQGETTIHNVPLISDISIMSDVLR
CLGARVERDGHTLTVDTSAVDKHETPYELVSKMRASISVLGPLVGRFGCARVAMPGGCQI
GARKIDMHLVGLEAIGVEFSIDHGFLEASTPNGLHGAHVVLDFPSVGATENLLMAAVAAE
GSTVIENAAREPEIVDLANMLVSMGTRVTGAGSDIIEVEGVPLSSLHPCEHTTVGDRIEA
GTFLAGGALTGGPVTVHGIDPSYLRVALMKLRAMGCDVETGDDWITVGRTRPLAPIDLQT
LPHPGFPTDLQAQFMLLAAFADGMSVITENVFENRFMFASELMRMGADIAIEDHHALVRG
VDVLQGADVSSTDLRAGAALVLAGIAGEGETRVHNIGHIDRGYEDYVGKLRALGADVVRA
ETEQAQTSR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagagatcatcatcgtacagggcaacaacacgctggccggcgacgtcgccgtg
tcgggcgcgaagaactcggcgctcaagctgatcgccgccgcgttgctgggccagggggaa
acgaccatccataacgtcccgctcatctcggatatcagcatcatgtccgacgtgctgcgc
tgtttgggcgcgcgggtggagcgcgacggccatacgctgacggtggacacctccgccgtc
gacaagcacgagaccccctacgagctggtgtcgaagatgcgtgcgagcatctcggtgctc
ggcccgctcgttggccgcttcggatgcgcccgcgtggccatgccgggcggctgtcagatc
ggcgctcgcaagatcgacatgcatcttgtcggcctcgaggctatcggcgtggagttctcc
atcgaccacggcttccttgaggccagcacgcccaacgggctgcacggcgcgcacgtcgta
ctcgacttccccagtgtgggagcaaccgagaacctgctcatggccgccgtggcggccgag
ggctccacggtcatagagaacgccgcgcgcgaacccgagatcgtggatcttgcgaacatg
ctcgtgtccatggggacgcgcgtcacaggcgcgggctcggacatcatcgaggtcgagggc
gtgccgctttcttcgctgcatccttgcgagcacacgacggtgggcgaccgcatcgaggcc
ggcaccttcctggccggaggcgcgctgacgggcggtcccgtcaccgtgcacggcatcgat
ccgtcgtatctgcgcgttgcgctcatgaagctccgcgccatgggctgcgacgtggagacg
ggcgacgactggatcaccgtgggccgcacgcgcccgctggctcccatcgacttgcagacg
ctgccgcatcccgggtttcccaccgaccttcaggcgcagttcatgctgctggccgcgttc
gccgacggcatgtccgtcatcaccgagaacgtgttcgagaaccgtttcatgttcgccagc
gagctcatgcgcatgggcgcggacatcgccatcgaggaccatcacgccctcgtgcgcggc
gtggacgtgctgcagggcgccgacgtgtcgtccaccgatctgcgcgccggggcggctctc
gtgctggccggcattgcgggggagggcgagactcgcgtgcacaacatcggccatatcgat
cgcggttacgaggactacgtgggcaagctgcgcgctctcggcgccgatgtcgtgcgcgct
gaaaccgagcaagcccagacgtcccggtag

DBGET integrated database retrieval system