KEGG   Eggerthella lenta: Elen_1105Help
Entry
Elen_1105         CDS       T00984                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ele  Eggerthella lenta
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ele00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ele00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1336616..1337905
Genome map
AA seq 429 aa AA seqDB search
MAEEIIIVQGNNTLAGDVAVSGAKNSALKLIAAALLGQGETTIHNVPLISDISIMSDVLR
CLGARVERDGHTLTVDTSAVDKHETPYELVSKMRASISVLGPLVGRFGCARVAMPGGCQI
GARKIDMHLVGLEAIGVEFSIDHGFLEASTPNGLHGAHVVLDFPSVGATENLLMAAVAAE
GSTVIENAAREPEIVDLANMLVSMGTRVTGAGSDIIEVEGVPLSSLHPCEHTTVGDRIEA
GTFLAGGALTGGPVTVHGIDPSYLRVALMKLRAMGCDVETGDDWITVGRTRPLAPIDLQT
LPHPGFPTDLQAQFMLLAAFADGMSVITENVFENRFMFASELMRMGADIAIEDHHALVRG
VDVLQGADVSSTDLRAGAALVLAGIAGEGETRVHNIGHIDRGYEDYVGKLRALGADVVRA
ETEQAQTSR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagagatcatcatcgtacagggcaacaacacgctggccggcgacgtcgccgtg
tcgggcgcgaagaactcggcgctcaagctgatcgccgccgcgttgctgggccagggggaa
acgaccatccataacgtcccgctcatctcggatatcagcatcatgtccgacgtgctgcgc
tgtttgggcgcgcgggtggagcgcgacggccatacgctgacggtggacacctccgccgtc
gacaagcacgagaccccctacgagctggtgtcgaagatgcgtgcgagcatctcggtgctc
ggcccgctcgttggccgcttcggatgcgcccgcgtggccatgccgggcggctgtcagatc
ggcgctcgcaagatcgacatgcatcttgtcggcctcgaggctatcggcgtggagttctcc
atcgaccacggcttccttgaggccagcacgcccaacgggctgcacggcgcgcacgtcgta
ctcgacttccccagtgtgggagcaaccgagaacctgctcatggccgccgtggcggccgag
ggctccacggtcatagagaacgccgcgcgcgaacccgagatcgtggatcttgcgaacatg
ctcgtgtccatggggacgcgcgtcacaggcgcgggctcggacatcatcgaggtcgagggc
gtgccgctttcttcgctgcatccttgcgagcacacgacggtgggcgaccgcatcgaggcc
ggcaccttcctggccggaggcgcgctgacgggcggtcccgtcaccgtgcacggcatcgat
ccgtcgtatctgcgcgttgcgctcatgaagctccgcgccatgggctgcgacgtggagacg
ggcgacgactggatcaccgtgggccgcacgcgcccgctggctcccatcgacttgcagacg
ctgccgcatcccgggtttcccaccgaccttcaggcgcagttcatgctgctggccgcgttc
gccgacggcatgtccgtcatcaccgagaacgtgttcgagaaccgtttcatgttcgccagc
gagctcatgcgcatgggcgcggacatcgccatcgaggaccatcacgccctcgtgcgcggc
gtggacgtgctgcagggcgccgacgtgtcgtccaccgatctgcgcgccggggcggctctc
gtgctggccggcattgcgggggagggcgagactcgcgtgcacaacatcggccatatcgat
cgcggttacgaggactacgtgggcaagctgcgcgctctcggcgccgatgtcgtgcgcgct
gaaaccgagcaagcccagacgtcccggtag

DBGET integrated database retrieval system