KEGG   Eggerthella lenta: Elen_1225Help
Entry
Elen_1225         CDS       T00984                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ele  Eggerthella lenta
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Elen_1225
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Elen_1225
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Elen_1225
Enzymes [BR:ele01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Elen_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1472243..1473628
Genome map
AA seq 461 aa AA seqDB search
MTEQAPHRLYLREDQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQEL
DDDTAYVDIPEPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAI
AQAYYAKAQDLDGITTETGAGQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETF
DAHVTPSPSDTTEIGRKMLAEHPDSSGSLGTAISEAVERALNIPGNKGRYTLGSVLNQVV
LHQSVIGLESYAAFEELGEYPDVVIGCAGGGSNLGGLIAPFMRDKIKGVRPDTRFVAVEP
ASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMSPIVSKLKHDG
YLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG
TGYFDMKAYDAYNRGEMSDHVPTDEELEAGFASIPHIEGVQ
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaagcaccgcatcgtctgtacctgcgcgaagaccagatcccgacgcagtgg
tacaacctgcgggccgacatgccggagaagccggagcccatccggctgccgaacggccag
gtcgcggcacctgaggatctggcacctgtgttctgcgacgagctggtgcgccaggagctg
gacgacgacacggcctacgtcgacatccccgaaccggtgttggagatgtaccgcatctac
cgcccgtcgcccttgtgccgcgcgtacaacctggagaaggccctcggcacgcccgccaag
atctactacaagttcgaaggcaacaacacgtccggctcgcacaagctgaactctgccatc
gcccaggcttattacgcgaaggctcaggatctcgacggcatcaccaccgagacgggtgcg
ggccagtggggcacggcgctcgccgaggcgtcggcgcatttcgggctcaatctggacgtg
ttcatggtgaagtgctcctacgagcagaagccgttccgccgcaacatcatggagacgttc
gatgcgcacgtgacgccctcgccgtccgataccaccgagatcggccgcaagatgctcgcc
gagcatcccgactcctcgggctcgctgggcacggccatctccgaggccgtggaacgcgcg
ctcaacattcccggcaacaagggccgctacacgctggggtcggtgctcaaccaggtggtg
ctgcaccagtcggtcatcggcttggagagctacgctgccttcgaggagctgggcgagtac
cccgacgtggtcatcggctgcgcgggcggcggctcgaacctcggcggcctcatcgcgccg
ttcatgcgcgacaagatcaaaggcgtccgtcccgacacgcgcttcgtcgccgtcgagccg
gccagctgcccgagcctcacgcgcgggcgctacgcctacgacttcgccgacacgggccgc
acctgcccgctcgcgaagatgtacacgctgggcaacggcttcctgcccagccccgaccat
gctggcggcctgcgctaccacggcatgagtcccatcgtgtcgaagctcaagcacgacggc
tacctggacgccgtggccgtgaagcagaccgacgtgttcgcggcggccgtggagttcgcg
cggctcgagaccatcctgccggctcccgagagcgcccacgccatcttccaggccgtggag
gaggccaagcgctgcgccgagacgggcgaggagaagacgatcctcttcggcctcacgggc
acgggctacttcgacatgaaggcctacgacgcgtacaaccgcggcgagatgagcgaccat
gtccccaccgacgaggagctggaggcgggcttcgccagcatcccgcacatcgagggcgtg
cagtag

DBGET integrated database retrieval system