KEGG   Eggerthella lenta: Elen_1225Help
Entry
Elen_1225         CDS       T00984                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ele  Eggerthella lenta
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Elen_1225
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Elen_1225
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Elen_1225
Enzymes [BR:ele01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Elen_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1472243..1473628
Genome map
AA seq 461 aa AA seqDB search
MTEQAPHRLYLREDQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQEL
DDDTAYVDIPEPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAI
AQAYYAKAQDLDGITTETGAGQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETF
DAHVTPSPSDTTEIGRKMLAEHPDSSGSLGTAISEAVERALNIPGNKGRYTLGSVLNQVV
LHQSVIGLESYAAFEELGEYPDVVIGCAGGGSNLGGLIAPFMRDKIKGVRPDTRFVAVEP
ASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMSPIVSKLKHDG
YLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG
TGYFDMKAYDAYNRGEMSDHVPTDEELEAGFASIPHIEGVQ
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaagcaccgcatcgtctgtacctgcgcgaagaccagatcccgacgcagtgg
tacaacctgcgggccgacatgccggagaagccggagcccatccggctgccgaacggccag
gtcgcggcacctgaggatctggcacctgtgttctgcgacgagctggtgcgccaggagctg
gacgacgacacggcctacgtcgacatccccgaaccggtgttggagatgtaccgcatctac
cgcccgtcgcccttgtgccgcgcgtacaacctggagaaggccctcggcacgcccgccaag
atctactacaagttcgaaggcaacaacacgtccggctcgcacaagctgaactctgccatc
gcccaggcttattacgcgaaggctcaggatctcgacggcatcaccaccgagacgggtgcg
ggccagtggggcacggcgctcgccgaggcgtcggcgcatttcgggctcaatctggacgtg
ttcatggtgaagtgctcctacgagcagaagccgttccgccgcaacatcatggagacgttc
gatgcgcacgtgacgccctcgccgtccgataccaccgagatcggccgcaagatgctcgcc
gagcatcccgactcctcgggctcgctgggcacggccatctccgaggccgtggaacgcgcg
ctcaacattcccggcaacaagggccgctacacgctggggtcggtgctcaaccaggtggtg
ctgcaccagtcggtcatcggcttggagagctacgctgccttcgaggagctgggcgagtac
cccgacgtggtcatcggctgcgcgggcggcggctcgaacctcggcggcctcatcgcgccg
ttcatgcgcgacaagatcaaaggcgtccgtcccgacacgcgcttcgtcgccgtcgagccg
gccagctgcccgagcctcacgcgcgggcgctacgcctacgacttcgccgacacgggccgc
acctgcccgctcgcgaagatgtacacgctgggcaacggcttcctgcccagccccgaccat
gctggcggcctgcgctaccacggcatgagtcccatcgtgtcgaagctcaagcacgacggc
tacctggacgccgtggccgtgaagcagaccgacgtgttcgcggcggccgtggagttcgcg
cggctcgagaccatcctgccggctcccgagagcgcccacgccatcttccaggccgtggag
gaggccaagcgctgcgccgagacgggcgaggagaagacgatcctcttcggcctcacgggc
acgggctacttcgacatgaaggcctacgacgcgtacaaccgcggcgagatgagcgaccat
gtccccaccgacgaggagctggaggcgggcttcgccagcatcccgcacatcgagggcgtg
cagtag

DBGET integrated database retrieval system