KEGG   Eggerthella lenta: Elen_1674Help
Entry
Elen_1674         CDS       T00984                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ele  Eggerthella lenta
Pathway
ele00240  Pyrimidine metabolism
ele00250  Alanine, aspartate and glutamate metabolism
ele01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Elen_1674
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Elen_1674
Enzymes [BR:ele01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Elen_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACV55640
JGI: Elen_1674
UniProt: C8WHP9
Position
complement(1976614..1977558)
Genome map
AA seq 314 aa AA seqDB search
MAFNHKHLIDITEYSADDIMTVLETAVRFKEVNERRIKQVPTLKGVTVVNMFNEPSTRTR
SSFEIAEKRLSANSLNFGGSSTSTVKGESLVDTVETLCAYKIDMIIVRDKHAGVPRKIAD
VSGAHVIDAGDGKHQHPTQALLDLYSIWEVKGDLNGLKVGVVGDIGHSRVCGSLIPALKI
MGCEVTVVAPPTLLPARPDILGADHVTTKLDEALPDLDVVYMLRIQRERLEGAPYPSLRE
YNMLYGLTKDREHLMKPDALICHPGPINRGVELDSYMADHPKRSVILDQVYAGILTRMAE
MYLLLGGSEDGLTA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaatcacaagcatctaatcgacatcacggagtactccgccgacgacatcatg
accgttctggaaacggcggtccgcttcaaggaagtcaacgagcgccgcatcaagcaggtg
cccacgctcaagggcgtcaccgtggtcaacatgttcaacgagccgtccactcgcacgcgc
tcctcgttcgagatcgccgagaagcgcctgagcgccaacagcctgaacttcggcggcagc
tccacctccacggtgaagggcgagagcctcgtggacacggtggagacgctgtgcgcctac
aagatcgacatgatcatcgtgcgcgacaagcacgccggcgtgccccgcaagatcgccgac
gtctccggcgcgcacgtcatcgatgcgggcgacggcaagcaccagcaccccacgcaggcg
ctgctggacctgtactccatctgggaggtcaagggcgacctgaacggcctcaaggtgggc
gtcgtgggcgacatcggccactcccgcgtgtgcggcagcctgatccccgcgctcaagatc
atgggttgcgaggtgacggtggtcgctccgccgacgctgctgcccgcgcgccccgacatc
ctgggcgccgaccacgtgaccacgaagctggacgaggcgctgcccgacctcgacgtggtg
tacatgctgcgcatccagcgcgagcgcctcgaaggcgcgccatacccgtcgctgcgcgag
tacaacatgctgtacggcctcacgaaggaccgcgagcacctcatgaagcccgacgccctc
atctgccaccccggccccatcaaccgcggcgtcgaactggatagctacatggccgaccac
ccgaagcgctcggtcattctcgatcaggtctatgccggcatcctgacccgcatggccgaa
atgtacctgctgctcggagggagcgaagatggccttactgcttaa

DBGET integrated database retrieval system