KEGG   Eggerthella lenta: Elen_1701Help
Entry
Elen_1701         CDS       T00984                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ele  Eggerthella lenta
Pathway
ele00010  Glycolysis / Gluconeogenesis
ele00620  Pyruvate metabolism
ele00640  Propanoate metabolism
ele00680  Methane metabolism
ele01100  Metabolic pathways
ele01110  Biosynthesis of secondary metabolites
ele01120  Microbial metabolism in diverse environments
ele01130  Biosynthesis of antibiotics
ele01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_1701
   00620 Pyruvate metabolism
    Elen_1701
   00640 Propanoate metabolism
    Elen_1701
  Energy metabolism
   00680 Methane metabolism
    Elen_1701
Enzymes [BR:ele01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Elen_1701
Lipid biosynthesis proteins [BR:ele01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Elen_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACV55666
JGI: Elen_1701
UniProt: C8WHS5
Position
complement(2006358..2008031)
Genome map
AA seq 557 aa AA seqDB search
MNHILKKYCPRIEFDSYEDFFENFKIDVPEAFNFGFDVVDEWARVDPEKRALVWCDDRDE
ERTFTFDDLSKLSNRAANAFRKLGIGKGDVVMMILRRRWEYWVCAVALCKLGATIIPASL
QLTKKDIVYRADSAQVKAVVCVNDEYVCGQMEEALPESPSIENRIIVAGERDGWTPFDQL
IEGESDEFERPRGEAGVTSKDIMLIYFTSGTTGMAKAVCHNFAHPLGHIITAKYWQQVEE
DALHMSVTDSGWAKFGWGKIYGQWIAGATVFAYDMDKFVPTKLLQKIQDYKLTTFCAPPT
MYRFMLQEDVSAYDLSSVHNFATAGEPLNAEVTLAWERLTGKRIREGFGQTEGPVLLATF
PWVDPRPGSMGKPSPLLNIKLLDDDGIEVPDGEEGAICVTGLKEAYPPGLFVGYYRDEER
TREAVGGEYYNLHDMAWRDSDGYCFFVGRNDDVIKCSGYRIGPFEVESALVEHPAVVECA
VTAAPDPIRGKVVKATVVLARGYEPSDELVRELQNHVKHTTAPYKYPRIVEFVDELPKTI
GGKIKRKLIRNNDGIED
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccatatcctgaaaaaatactgcccccgcatcgagttcgattcgtacgaggacttc
ttcgagaacttcaagatcgacgtgcccgaggcgttcaacttcggcttcgacgtggtggac
gagtgggctcgcgtcgatcccgagaagcgtgcgctcgtatggtgcgacgatcgcgacgag
gagcgcaccttcacgttcgacgacttgtcgaagctgtcgaaccgggcggccaacgcgttt
cgcaagctcggcatcggcaagggggacgtggtcatgatgatcctgcgccgtcgctgggaa
tactgggtgtgcgccgtggcgctgtgcaagctgggcgccaccatcatccccgcgtcgttg
cagctgacgaagaaggacatcgtctaccgtgccgatagcgcgcaggtgaaggcggtcgtt
tgcgtgaacgacgagtacgtatgcgggcagatggaggaagcgctgcctgaatcgccgtcc
atcgagaaccgcatcatcgtggcgggcgagcgcgacggctggacgccgttcgaccagctg
atcgagggcgagtccgacgagttcgagcgcccgaggggcgaggcgggcgtcacgagcaag
gacatcatgctcatctacttcacgtcaggcaccacgggcatggcgaaagcggtgtgccac
aacttcgcccacccgttgggccatatcatcaccgcgaagtactggcagcaggtggaagag
gacgcgctgcacatgagcgtgaccgacagcggctgggcgaagttcggctggggcaagatc
tacggccagtggatcgccggcgccaccgtcttcgcctacgacatggacaagttcgtgccc
acgaagctgctgcagaagatccaggactacaagctgaccacgttctgcgcgccgccgacg
atgtaccgcttcatgctgcaggaggacgtgagcgcctacgacctgtcgagcgtgcacaac
ttcgccacggcgggcgagccgctgaacgccgaggtcacgttggcgtgggagcgtttgacg
ggcaagaggatccgcgagggcttcggccagaccgagggtccggtgctgctggcgacgttc
ccgtgggtcgacccgcgtccgggttccatgggcaagccttcgccgcttttgaacatcaag
ctgctggacgacgacggcatcgaggtgcccgacggcgaggagggcgccatctgcgtgacg
gggctcaaggaggcgtacccgccgggactgttcgtggggtactatcgcgacgaggagcgc
acgcgcgaggccgtgggcggggagtactacaacctgcacgacatggcgtggcgcgactcc
gacggctactgtttcttcgtgggtcgcaacgacgacgtcatcaagtgctcgggttaccgc
atcgggcccttcgaggtggagagcgcgctcgtggagcatcccgccgtggtggagtgcgcc
gtcacggcggcgcccgatcccatccgcggcaaggtggtgaaggccaccgtcgtgttggcg
cgcggttacgagccttccgacgagctggtgcgcgagctgcagaaccacgtgaagcacacg
acggcgccctacaagtatccgcgcatcgtggagttcgtcgacgagctgcccaagaccatc
ggcggcaagatcaagcgcaagctgatcaggaacaacgacggcatcgaggattaa

DBGET integrated database retrieval system