KEGG   Eggerthella lenta: Elen_1777Help
Entry
Elen_1777         CDS       T00984                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ele01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ele01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ele00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ele00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2083296..2084069)
Genome map
AA seq 257 aa AA seqDB search
MARKPMMAGNWKMNNTIAEAVVLTQEISNQYDKETWGEDVDIVICPPYVDLKPAKTVLDF
DKTKVAVNAQNVYWEPSGAYTGEISVPMIKEIGCAGSIVGHSERRELFGETNEDVNRKVK
ALVEAGLYAIVCVGESLAVRDEGTTEEFVCAQVRAAFAGVDAADAQRCVVAYEPIWAIGT
GRTATPEQAEAVCAAIRATLADLYGAEVAEEMRVLYGGSMNPGNVEGLMAQPNIDGGLIG
GASLKAASFVQLINACL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaaacccatgatggcaggcaactggaagatgaacaacaccatcgccgaggcc
gtggtgctgacgcaggagatctccaaccagtacgacaaggagacctggggcgaggacgtc
gacatcgtcatctgcccgccctacgtcgacctcaagccggccaagaccgtgctcgacttc
gacaagacgaaggtggccgtgaacgcccagaacgtgtactgggagccctccggcgcctac
accggagagatctcggtgcccatgatcaaggagatcggctgcgcgggcagcatcgttggc
cactccgagcgccgcgagctgttcggcgagacgaacgaggacgtgaaccgcaaggtgaag
gcgctcgtcgaggcgggcctgtacgccatcgtgtgcgtgggcgagtcgctggccgtgcgc
gacgagggcaccaccgaggagttcgtgtgcgcccaggtgcgcgccgcgttcgccggcgtg
gacgccgccgacgcgcagcgctgcgtggtggcctacgagcccatctgggccatcggcacg
gggcgcacggccacgcccgagcaggccgaggccgtctgcgccgccatccgcgcgacgctc
gccgacctgtacggcgcggaggtcgccgaggagatgcgcgtgctgtacggcggctccatg
aacccgggcaacgtcgagggcctcatggcccagccgaacatcgacggcggcctcatcgga
ggcgccagcctgaaggcggcgtctttcgtgcagctgatcaacgcctgcctgtag

DBGET integrated database retrieval system