KEGG   Eggerthella lenta: Elen_1777Help
Entry
Elen_1777         CDS       T00984                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Elen_1777
   01230 Biosynthesis of amino acids
    Elen_1777
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_1777
   00051 Fructose and mannose metabolism
    Elen_1777
   00562 Inositol phosphate metabolism
    Elen_1777
Enzymes [BR:ele01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Elen_1777
Exosome [BR:ele04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Elen_1777
  Exosomal proteins of bladder cancer cells
   Elen_1777
  Exosomal proteins of melanoma cells
   Elen_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2083296..2084069)
Genome map
AA seq 257 aa AA seqDB search
MARKPMMAGNWKMNNTIAEAVVLTQEISNQYDKETWGEDVDIVICPPYVDLKPAKTVLDF
DKTKVAVNAQNVYWEPSGAYTGEISVPMIKEIGCAGSIVGHSERRELFGETNEDVNRKVK
ALVEAGLYAIVCVGESLAVRDEGTTEEFVCAQVRAAFAGVDAADAQRCVVAYEPIWAIGT
GRTATPEQAEAVCAAIRATLADLYGAEVAEEMRVLYGGSMNPGNVEGLMAQPNIDGGLIG
GASLKAASFVQLINACL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaaacccatgatggcaggcaactggaagatgaacaacaccatcgccgaggcc
gtggtgctgacgcaggagatctccaaccagtacgacaaggagacctggggcgaggacgtc
gacatcgtcatctgcccgccctacgtcgacctcaagccggccaagaccgtgctcgacttc
gacaagacgaaggtggccgtgaacgcccagaacgtgtactgggagccctccggcgcctac
accggagagatctcggtgcccatgatcaaggagatcggctgcgcgggcagcatcgttggc
cactccgagcgccgcgagctgttcggcgagacgaacgaggacgtgaaccgcaaggtgaag
gcgctcgtcgaggcgggcctgtacgccatcgtgtgcgtgggcgagtcgctggccgtgcgc
gacgagggcaccaccgaggagttcgtgtgcgcccaggtgcgcgccgcgttcgccggcgtg
gacgccgccgacgcgcagcgctgcgtggtggcctacgagcccatctgggccatcggcacg
gggcgcacggccacgcccgagcaggccgaggccgtctgcgccgccatccgcgcgacgctc
gccgacctgtacggcgcggaggtcgccgaggagatgcgcgtgctgtacggcggctccatg
aacccgggcaacgtcgagggcctcatggcccagccgaacatcgacggcggcctcatcgga
ggcgccagcctgaaggcggcgtctttcgtgcagctgatcaacgcctgcctgtag

DBGET integrated database retrieval system