KEGG   Eggerthella lenta: Elen_1966Help
Entry
Elen_1966         CDS       T00984                                 

Definition
(GenBank) peptidase M42 family protein
Organism
ele  Eggerthella lenta
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2303345..2304496)
Genome map
AA seq 383 aa AA seqDB search
MKNKQVKFLKQLLETPSATGTEIAVAELVRERLAGTADEIQTDVMGSVHARLSGTGVAPS
LMLSAHMDEIGLMVTYISDEGFLSVSSVGGVDAAILPGMRVDVHASNSFEPLRGVVGRKP
IHLIEPDERKNVTPIDKLVIDLGMPAKRVKKLVMVGDVITFGVGFERFGKNMAVSRAFDD
KAGVWVAVRVLETLAKEGRAPGDFIVAATVQEEIGTRGAITSAYGLDPDVAIAFDVTHAT
DYPGIDKTKYGKIVCGEGPVIARGPNINPAVFERLVAAAEAEGLPYQIEAEPGVTGTDAR
SIQISRGGVPTGLVSVPLRYMHTPTEVVSLDDLDATVKLLARFARDLDEDACFVPGMGDA
VTEGDGAGAESAAQMQFDETGVE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaagcaggtgaaattcctcaagcaactgctcgagaccccgtcggccaccggc
accgagatcgccgtggccgaactggtgcgcgagcgcctggccggcacggccgacgagatc
cagaccgacgtcatgggctcggtccatgcccgcctgtcgggcacgggcgtggccccgtcg
ctcatgctgtcggcccacatggacgagatcggcctcatggtcacgtacatctccgacgag
ggcttcctgtccgtgtcgtccgtcggcggcgtggacgcggccatcctcccgggcatgcgc
gtggacgtgcacgcgtcgaactccttcgagccgctgcgcggcgtggtgggccgcaagccc
atccacctcatcgagcccgacgagcgcaagaacgtcacgcccatcgacaagctggtcatc
gacctcggcatgccggcgaagcgtgtgaagaagctcgtcatggtgggcgacgtcatcacc
ttcggcgtgggcttcgagcgcttcggcaagaacatggctgtctcgcgcgccttcgacgac
aaggcgggcgtgtgggtcgctgtgcgcgtgctggagacgctcgctaaggagggccgcgcg
cccggcgacttcatcgtggccgccaccgttcaggaggagatcggcacgcgcggcgccatt
acgtccgcgtacggcctggaccccgatgtggccatcgcgttcgacgtgacgcacgccacc
gactatcccggcatcgacaagacgaagtacggaaagatcgtctgcggcgagggtcccgtt
atcgcgcgcggccccaacatcaacccggctgtgttcgagcgcctcgtggcggcggccgag
gccgagggtctgccgtaccagatcgaggccgagcccggcgtcaccggcaccgacgcccgt
tccatccagatctcccgcggcggcgtccccaccggcctcgtgtcggtgcccctgcgctac
atgcatacgcccaccgaggtggtcagcctcgacgacctcgacgcaacggtgaagctgctc
gcccgtttcgcgcgcgacctggacgaggacgcctgcttcgtgccgggcatgggcgacgcg
gtgaccgagggcgacggcgctggcgccgagtccgctgcgcagatgcagttcgacgagacg
ggcgtggagtag

DBGET integrated database retrieval system