KEGG   Eggerthella lenta: Elen_1966Help
Entry
Elen_1966         CDS       T00984                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ele  Eggerthella lenta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Elen_1966
Enzymes [BR:ele01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Elen_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2303345..2304496)
Genome map
AA seq 383 aa AA seqDB search
MKNKQVKFLKQLLETPSATGTEIAVAELVRERLAGTADEIQTDVMGSVHARLSGTGVAPS
LMLSAHMDEIGLMVTYISDEGFLSVSSVGGVDAAILPGMRVDVHASNSFEPLRGVVGRKP
IHLIEPDERKNVTPIDKLVIDLGMPAKRVKKLVMVGDVITFGVGFERFGKNMAVSRAFDD
KAGVWVAVRVLETLAKEGRAPGDFIVAATVQEEIGTRGAITSAYGLDPDVAIAFDVTHAT
DYPGIDKTKYGKIVCGEGPVIARGPNINPAVFERLVAAAEAEGLPYQIEAEPGVTGTDAR
SIQISRGGVPTGLVSVPLRYMHTPTEVVSLDDLDATVKLLARFARDLDEDACFVPGMGDA
VTEGDGAGAESAAQMQFDETGVE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaagcaggtgaaattcctcaagcaactgctcgagaccccgtcggccaccggc
accgagatcgccgtggccgaactggtgcgcgagcgcctggccggcacggccgacgagatc
cagaccgacgtcatgggctcggtccatgcccgcctgtcgggcacgggcgtggccccgtcg
ctcatgctgtcggcccacatggacgagatcggcctcatggtcacgtacatctccgacgag
ggcttcctgtccgtgtcgtccgtcggcggcgtggacgcggccatcctcccgggcatgcgc
gtggacgtgcacgcgtcgaactccttcgagccgctgcgcggcgtggtgggccgcaagccc
atccacctcatcgagcccgacgagcgcaagaacgtcacgcccatcgacaagctggtcatc
gacctcggcatgccggcgaagcgtgtgaagaagctcgtcatggtgggcgacgtcatcacc
ttcggcgtgggcttcgagcgcttcggcaagaacatggctgtctcgcgcgccttcgacgac
aaggcgggcgtgtgggtcgctgtgcgcgtgctggagacgctcgctaaggagggccgcgcg
cccggcgacttcatcgtggccgccaccgttcaggaggagatcggcacgcgcggcgccatt
acgtccgcgtacggcctggaccccgatgtggccatcgcgttcgacgtgacgcacgccacc
gactatcccggcatcgacaagacgaagtacggaaagatcgtctgcggcgagggtcccgtt
atcgcgcgcggccccaacatcaacccggctgtgttcgagcgcctcgtggcggcggccgag
gccgagggtctgccgtaccagatcgaggccgagcccggcgtcaccggcaccgacgcccgt
tccatccagatctcccgcggcggcgtccccaccggcctcgtgtcggtgcccctgcgctac
atgcatacgcccaccgaggtggtcagcctcgacgacctcgacgcaacggtgaagctgctc
gcccgtttcgcgcgcgacctggacgaggacgcctgcttcgtgccgggcatgggcgacgcg
gtgaccgagggcgacggcgctggcgccgagtccgctgcgcagatgcagttcgacgagacg
ggcgtggagtag

DBGET integrated database retrieval system