KEGG   Eggerthella lenta: Elen_2043Help
Entry
Elen_2043         CDS       T00984                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ele  Eggerthella lenta
Pathway
ele00521  Streptomycin biosynthesis
ele00523  Polyketide sugar unit biosynthesis
ele01130  Biosynthesis of antibiotics
Module
ele_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Elen_2043
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Elen_2043
Enzymes [BR:ele01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Elen_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACV56007
JGI: Elen_2043
UniProt: C8WIW5
Position
complement(2393796..2394368)
Genome map
AA seq 190 aa AA seqDB search
MAAGDSVKHGNFTFTETSIEGVLVVDVTAYGDERGYFAETYKRPDFVAGGIDAEFVQDNQ
SSSTKGVLRGLHFQIHHPQSKLVRVVSGEVFDVAVDLRPGSATYGAWEGVVLSAENRRQF
FVPRGFAHGFLVLSDIAEFCYKCDDVYHPNDEGGLMWNDPEIGIEWPIPEGMELVLSEKD
KAHPGLSGLS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaggagacagcgtcaagcacggcaacttcacgttcaccgagacctccatcgag
ggggttctcgtcgtggacgtcacggcctacggcgacgagcgcggctacttcgccgagacc
tacaagcgccccgatttcgtcgcgggcggcatcgatgcagagttcgtgcaggataaccag
tcctcctcgaccaaaggcgtgctgcgtgggttgcacttccagatacaccacccccagtcc
aagctcgtgcgcgtggtgtccggagaggtgttcgacgtggccgtcgacctgcgcccgggc
agtgccacgtacggcgcatgggagggcgtggtgctgtcggcggagaaccgccgccagttc
ttcgtgccgcgcgggttcgcccacggcttcctcgtgctgtccgacatcgccgagttctgc
tacaagtgcgacgacgtgtaccatcccaacgacgagggcggcctcatgtggaacgacccc
gagatcggcatcgaatggcccatacccgagggcatggagctcgtgctgagcgagaaggac
aaggcgcacccggggttgagcgggctctcgtag

DBGET integrated database retrieval system