KEGG   Eggerthella lenta: Elen_2067Help
Entry
Elen_2067         CDS       T00984                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ele  Eggerthella lenta
Pathway
ele00860  Porphyrin and chlorophyll metabolism
ele01100  Metabolic pathways
ele01110  Biosynthesis of secondary metabolites
ele01120  Microbial metabolism in diverse environments
Module
ele_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Elen_2067
Enzymes [BR:ele01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Elen_2067
Exosome [BR:ele04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Elen_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF1508
Motif
Other DBs
NCBI-ProteinID: ACV56030
JGI: Elen_2067
UniProt: C8WIY9
Position
complement(2433757..2434749)
Genome map
AA seq 330 aa AA seqDB search
MGFPAYRPRRMRANPAVRAFVRETRVEPGDLVYPVFVKPGAGVRDEVASMPGVFQLSIDQ
LAAEVDELRSCRVNSLMLFGLPARKDERGSEAYDDRGVVQQAVRAIKEHAPDFHVITDVC
LCEYTSHGHCGVLDERGGVDNDETLGLLAAEAVSHARAGADMVAPSDMMDGRVGALRSAL
DEAGFSHVPIMAYAAKYASGYYGPFRDAADSAPAFGDRSAYQMDPANSVEALREVRLDIE
EGADLVIVKPALSYLDVVRRVKDAFAFPTVAYNVSGEYAMVKAAAAQGWIDERRVVLETL
LSMKRAGADAIITYHAKDAARWIIGGRHGR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggatttcccgcttaccgtccgcgccgcatgcgtgcgaaccccgcggtgcgcgcgttc
gtgcgcgagacgcgcgtggaaccgggcgatctggtatacccggtgttcgtgaagccgggg
gccggcgtgcgcgacgaggtggcgtccatgccgggcgtgttccagctttcgatcgaccag
ctggcggccgaggtggacgagcttcgaagctgccgcgtgaactcgctcatgctgttcggc
cttcctgcgcgcaaggacgagcggggcagcgaagcttacgacgaccgcggcgtggtgcag
caggccgtgcgcgccatcaaggaacacgcgcccgacttccacgtgatcaccgacgtgtgc
ttgtgcgagtacacgagccacggccattgcggcgtgctcgacgagcgcgggggcgtggac
aacgacgagacgctcgggctcctggcggccgaggcggtgagccatgcgcgcgccggagcc
gacatggtggccccgtccgacatgatggacgggcgcgtgggcgcgctgcgctcggcgctc
gacgaggcgggcttttcgcacgtgcccatcatggcgtatgcggcgaagtacgcgtcgggc
tactacgggccgttccgcgatgcggccgattcggcgccggcgttcggcgaccgctcggcg
taccagatggatcccgcgaacagcgtcgaggcgctgcgcgaggtgcgcctcgacatcgag
gagggggccgaccttgtcatcgtgaagccggcgctatcctatctggacgtggtgcggcgc
gtgaaggacgccttcgcgtttcccaccgtggcctacaacgtgtcgggcgagtacgccatg
gtgaaggccgccgccgcgcaagggtggatcgacgagcgccgcgtggtgctggagacgctg
ctttccatgaagcgcgccggcgccgacgcaatcatcacctaccatgcgaaggacgctgcg
cgctggatcatcggaggccgtcatggccgctga

DBGET integrated database retrieval system