KEGG   Eggerthella lenta: Elen_2089Help
Entry
Elen_2089         CDS       T00984                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ele  Eggerthella lenta
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Elen_2089
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Elen_2089
Enzymes [BR:ele01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Elen_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2456291..2458333
Genome map
AA seq 680 aa AA seqDB search
MTEHYGYAGKILIVNLTDRTSQTIDTEPYIEWVGGHGMASKLFWDYCEDKTVEAVDPGNV
LVFAATPFSGAVVPAASARCEFTGISPFSLPEWYNRSSMGGRLAGMMKEAGYDACVVRGK
AEAPVWISVVNDQVTFNDATDLWGLDTFECQERIWDEVTHGTAPGSWYELTKGRDGGRTT
QRPSVICIGPAGENLARVSCIVHDAGHVTGQSGFGAVFGAKNLKAMSFIGSKSIPIADPA
ALVRLRLEVQEKFGYDIDAGKVPGAPGSPGAASTVLDTSPTVSRAEGCRGCFKNCRNLYP
GGVGNELTCSAGLYFTDSGKIDEQLAAYSLLSKLGLNGYEIDMPVYLHNLYKRGVMGKGK
DIDTDLPFEQYGTYAFIEELLMRIAYRREIGDDLAEGIARAAQKWGRWDEDTSSGLLARP
NWGYCEHNEPRAEVEWSYGSIFSERDINEHGVHNAVYNTSIMAVLTGAEPPVSAENMAKQ
LADQSGLGDPLCFDWSEEGIYSDARVREIHWNRAYGRFWLQSLGMCDWVWPNFISRKHTA
ETGSTYGATPEYEVKFFQAVTGRDLSYEESIELGHKFWVLDRAIWALEGRHRDQEVFTNY
VYDVKTTKPFPLVVFEDGKWSYSLCQGRTLDRDKFEDFKTRFYAHEGFEESTGRPTRSGL
EALDLGFAADKLEAAGKLGA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacattacggctacgccggcaagatactcatcgtgaacctgaccgaccgcacc
tcccagaccatcgacaccgaaccttacatcgaatgggtgggcggccacgggatggcctcg
aagctgttctgggactactgcgaggacaagaccgtggaggcggtcgatccgggaaacgtg
ctggtgttcgccgccacgccgttctcgggcgccgtggtgccggccgcctcggcgcgctgc
gagttcacgggcatcagcccgttctcgctgcccgaatggtacaaccgctccagcatgggc
ggccgtttggccggcatgatgaaggaagcgggctacgacgcctgcgtggtgcgcgggaaa
gcggaagcgcccgtgtggatcagcgtggtgaacgaccaagtgacgttcaacgacgcgacc
gacctttggggactcgataccttcgagtgccaggagaggatctgggacgaggtgacgcac
ggcaccgcccccggctcgtggtacgagctgacgaaggggcgcgacggaggccgcaccacg
cagcgaccgtccgtcatctgcatcggacctgccggcgagaacctggcgcgcgtgtcgtgc
atcgtgcacgatgccggccacgtgacgggacagagcggcttcggcgcggtgttcggcgcc
aagaacctcaaggcgatgagcttcatcggctcgaagagcatacccatcgccgaccccgcc
gcgctcgtgaggctgcggttggaagtgcaggagaagttcggctacgacatcgacgccggc
aaggttccgggcgcgccgggcagcccgggcgccgcatccaccgtgctggacacgagcccc
acggtgtcgcgcgcagaaggatgccgcggctgcttcaagaactgccgtaacctgtacccc
ggcggcgtgggcaacgagctgacctgctcggccggcctgtacttcaccgactcgggcaag
atcgacgagcagctggccgcctacagcctgctgtcgaagctggggctgaacggctacgag
atcgacatgcccgtgtacctgcacaacctctacaagaggggcgtcatgggcaagggcaag
gacatcgacaccgatctgcccttcgagcagtacggcacctacgcgttcatcgaggagctg
ctgatgcgcatcgcctaccgccgcgagatcggcgacgacctggccgagggcatcgcgcgc
gcggcgcagaagtgggggcgttgggacgaggacacgtcgtcgggcctgctggcgcgcccg
aactggggctactgcgagcacaacgagccgcgcgccgaggtggaatggagctacggaagc
atcttcagcgagcgagacatcaacgagcacggcgtacacaacgcggtgtacaacacctcc
atcatggcggtgctcaccggcgccgagccgcccgtctcggccgagaacatggccaagcag
ctggccgatcagtccgggctgggcgacccgctgtgcttcgactggagcgaggagggcatc
tattccgatgcgcgcgtgcgcgagatccactggaaccgcgcctacgggcgcttctggctg
cagtcgctgggcatgtgcgactgggtgtggccgaacttcatcagccgcaagcacaccgcc
gagacgggctcgacgtacggggccacgcccgagtacgaggtgaagttcttccaggccgtc
accgggcgcgacctctcctacgaggaaagcatcgagctggggcacaagttctgggtgctc
gaccgcgccatctgggcgctggagggacgccatcgcgaccaggaggtgttcacgaactac
gtgtacgacgtgaagaccaccaagcccttccccctcgtggtgttcgaggacgggaagtgg
agctactcgctgtgccagggccgcacgctcgaccgcgacaagttcgaggacttcaagacg
cgcttctacgcccacgaagggttcgaggagtccacgggtcgcccgacgcgctccgggctc
gaggcgcttgacctcggcttcgccgccgacaagctggaagcggccggaaagctgggagcg
tga

DBGET integrated database retrieval system