KEGG   Eggerthella lenta: Elen_2100Help
Entry
Elen_2100         CDS       T00984                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ele  Eggerthella lenta
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Elen_2100
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Elen_2100
Enzymes [BR:ele01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Elen_2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2470301..2471803)
Genome map
AA seq 500 aa AA seqDB search
MGKTCTELFAGIDCTILGNADDEVNGIAYRSDRVQPGDAFFCVVGMTTDGHSFAQDAIDR
GAKVLVVERKVYLADATDVTEIVVKDTRKAMAAAAANFYDHPSKDIALVGITGTNGKTTT
TYLVEHIARVAGKRTGVIGTVGIRIGDEAEKSAHTTPESPDLQQLFARMRDARCDVVAME
VSSHALDLDRTWDAAFAVTAFSNLTQDHLDYHHTFEAYFEAKARLFSKDYPAKRVICIDD
KWGKELLRRCSVAEDSVVTTGFDPSAQIHPVDVQYAPTHTTVTLDVRGSLHTFDYPLVGK
FNVENVMCAFGIGLQLGFPAETIVEALEEAPQIPGRLERVSAPNTGGVSVFVDYAHTPDA
LEKALASIMALTPGRTVCVFGCGGDRDASKRPIMGKAALAADHAVVTSDNPRTEDPQAII
EDIVSGMSSGAGRFEVEADRRAAIARAIAQAKPGDSILIAGKGHEDYQLVGDQVLSFDDR
IVAAEELARAFGDEPAGEDR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacctgtaccgaactgttcgcaggtatcgactgcaccatcctcggcaacgcc
gacgacgaggtgaacggtatcgcctaccgcagcgaccgggtgcaacccggcgacgcgttc
ttctgcgtggtaggcatgacgacggatgggcactcgttcgcccaggacgccatcgatcgg
ggcgcgaaagtgctcgtggtcgagcgcaaggtgtacctggccgacgctacggacgtcacg
gagatcgtggtgaaggatacgcgcaaggccatggcggccgcggcggcgaacttctacgac
catccttccaaggacattgcgctggtgggcatcaccggcaccaacggcaagaccaccacg
acctacctggtagagcacatcgcgcgggtagcggggaagcgcacgggcgtcatcggaacc
gtgggcatccgcatcggcgacgaggccgagaaatcggctcataccacgccggaatcgccc
gatttgcagcagctgttcgcccgcatgcgcgatgcgcgctgcgacgtcgtggccatggag
gtgagctctcatgcgctcgacctcgatcgcacgtgggacgccgcattcgccgttacggcg
ttctccaacttgacgcaggatcacctggactaccatcacacgttcgaggcctacttcgag
gcgaaggcgcgcctgttctcgaaagattatccggccaagcgcgtgatctgcatcgacgac
aagtggggcaaagagctgctgcggcgttgctcggttgccgaagacagcgtggtcacgacg
ggcttcgatccttccgcgcagatacatcccgtggacgtgcagtatgctcctacccacacc
accgtcacgctcgacgtgcgcggcagcttgcatacattcgactacccgctcgtgggcaag
ttcaacgtggagaacgtcatgtgcgccttcggcatcgggctgcagctgggcttcccggcc
gagaccatcgtcgaagcgctcgaggaggcgccgcagatcccgggtcgtttggagcgcgtg
agcgcgccgaacacgggcggcgtgtcggtgttcgtggactacgcccacacgcccgacgcg
ctggagaaggcgctcgcgtccatcatggcgctcacgcccggccgcaccgtctgcgtgttc
ggctgcggcggcgaccgcgatgccagcaagcgtcccatcatgggcaaggccgccctggcg
gccgaccatgcggtggtgacgtcggacaacccgcgcaccgaagatccgcaggccatcatc
gaggacatcgtgagcggaatgagctcgggagccggccgcttcgaagtggaggccgaccgt
cgcgccgccatcgcgcgcgccatcgcacaggcgaagccgggcgactcgattctcatcgcg
ggcaagggccacgaggactatcagctcgtgggcgaccaagtgctctcgttcgacgatcgc
atcgtggccgccgaggagctcgcgcgtgcgttcggcgacgaacccgcaggcgaggatcga
tag

DBGET integrated database retrieval system