KEGG   Eggerthella lenta: Elen_2578Help
Entry
Elen_2578         CDS       T00984                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ele  Eggerthella lenta
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Elen_2578
   00052 Galactose metabolism
    Elen_2578
   00500 Starch and sucrose metabolism
    Elen_2578
   00520 Amino sugar and nucleotide sugar metabolism
    Elen_2578
Enzymes [BR:ele01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Elen_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3017333..3018151)
Genome map
AA seq 272 aa AA seqDB search
MPMKALIPAAGLGTRFLPATKAQPKEMLLVVDRPAIQYVVEEGLASDADEVVIINSREKK
AIEEHFSPNPELVELLRARGKDAYADAVERVGNYNVSYVYQDEALGLGHAVRCAHEKTGD
EPFYVLLGDVLVPDNKMLPRMQEVSDAHGGASVIAVMPVPDDQVSRFGVIAGAAVADDVW
KIDALVEKPALEDAPSNLAVFGRYLLSARVMELLADVEPGVGGEIQLTDALDAVLREEEM
YALIIDPADGFDTGTVESWLETNNVLFGRAAE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgaaggctctcattcccgctgccggcctcggcacgcgcttcctgcccgccacg
aaggcgcagccgaaggaaatgctgctggtagtcgaccgaccggccatccagtacgtggtg
gaggagggcctcgcgtcggacgccgacgaggtggtcatcatcaacagccgcgagaagaag
gccatcgaggagcacttctcgccgaacccggagcttgtggagctgttgcgcgcccgcggg
aaggatgcgtatgccgacgcagtggagcgcgtgggcaactacaacgtgagctacgtgtac
caggacgaggcgctgggcttggggcatgcggtgcggtgcgcgcacgagaagacgggcgac
gagccgttctacgtgctgttgggcgacgtgctggtgcccgacaacaagatgctgccgcgc
atgcaggaggtgtccgacgcacacggcggcgccagcgtcatcgcggtcatgccggttccg
gacgaccaggtcagccgcttcggcgtcatcgcgggcgcggccgtggccgacgacgtgtgg
aagatcgacgcgctggtggagaagccggcgttggaggacgcgccgtcgaacctggccgtg
ttcggccgctacctcctcagcgctcgcgtgatggagcttctggccgacgtcgagcccggc
gtgggcggcgagatccagctgaccgacgcgctggacgccgtgctgcgcgaggaggagatg
tatgcgctgattatcgaccccgccgacggcttcgacaccggcacggtggaaagctggctg
gaaaccaacaacgtgctgttcgggcgcgcagccgaatag

DBGET integrated database retrieval system