KEGG   Eggerthella lenta: Elen_2578Help
Entry
Elen_2578         CDS       T00984                                 

Definition
(RefSeq) nucleotidyl transferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ele  Eggerthella lenta
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Elen_2578
   00052 Galactose metabolism
    Elen_2578
   00500 Starch and sucrose metabolism
    Elen_2578
   00520 Amino sugar and nucleotide sugar metabolism
    Elen_2578
Enzymes [BR:ele01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Elen_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3017333..3018151)
Genome map
AA seq 272 aa AA seqDB search
MPMKALIPAAGLGTRFLPATKAQPKEMLLVVDRPAIQYVVEEGLASDADEVVIINSREKK
AIEEHFSPNPELVELLRARGKDAYADAVERVGNYNVSYVYQDEALGLGHAVRCAHEKTGD
EPFYVLLGDVLVPDNKMLPRMQEVSDAHGGASVIAVMPVPDDQVSRFGVIAGAAVADDVW
KIDALVEKPALEDAPSNLAVFGRYLLSARVMELLADVEPGVGGEIQLTDALDAVLREEEM
YALIIDPADGFDTGTVESWLETNNVLFGRAAE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgaaggctctcattcccgctgccggcctcggcacgcgcttcctgcccgccacg
aaggcgcagccgaaggaaatgctgctggtagtcgaccgaccggccatccagtacgtggtg
gaggagggcctcgcgtcggacgccgacgaggtggtcatcatcaacagccgcgagaagaag
gccatcgaggagcacttctcgccgaacccggagcttgtggagctgttgcgcgcccgcggg
aaggatgcgtatgccgacgcagtggagcgcgtgggcaactacaacgtgagctacgtgtac
caggacgaggcgctgggcttggggcatgcggtgcggtgcgcgcacgagaagacgggcgac
gagccgttctacgtgctgttgggcgacgtgctggtgcccgacaacaagatgctgccgcgc
atgcaggaggtgtccgacgcacacggcggcgccagcgtcatcgcggtcatgccggttccg
gacgaccaggtcagccgcttcggcgtcatcgcgggcgcggccgtggccgacgacgtgtgg
aagatcgacgcgctggtggagaagccggcgttggaggacgcgccgtcgaacctggccgtg
ttcggccgctacctcctcagcgctcgcgtgatggagcttctggccgacgtcgagcccggc
gtgggcggcgagatccagctgaccgacgcgctggacgccgtgctgcgcgaggaggagatg
tatgcgctgattatcgaccccgccgacggcttcgacaccggcacggtggaaagctggctg
gaaaccaacaacgtgctgttcgggcgcgcagccgaatag

DBGET integrated database retrieval system