KEGG   Eggerthella lenta: Elen_2679Help
Entry
Elen_2679         CDS       T00984                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ele  Eggerthella lenta
Pathway
ele00480  Glutathione metabolism
ele00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Elen_2679
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Elen_2679
Enzymes [BR:ele01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Elen_2679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: ACV56628
JGI: Elen_2679
UniProt: C8WMD3
Position
complement(3100474..3101028)
Genome map
AA seq 184 aa AA seqDB search
MASSIYDFTVKDQQGNDVSLADYRGRVLLVVNTATECGFTPTYAQLQELYTALHERGLDI
LDFPCDQFGHQAPGTNEEIAQFCTSRFGVTFPQFAKIEVNGEGADPLFTYLQQQKGFEGF
DDGHELTPILEDLLSKDDPDYAGKPDIKWNFTKFLVDREGNVVRRFEPTASIPDVVAPAV
EELL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagcatctatgactttaccgtaaaggatcagcagggcaacgacgtgtcgctc
gccgactaccggggtcgcgtgctgctggtggtgaacaccgccactgagtgcggcttcacg
cccacgtacgcccagctccaggagctgtacaccgcgttgcatgagcgaggcctggacatc
ctcgacttcccgtgcgaccagttcggccaccaggcgcccggcacgaacgaggagatcgcg
cagttctgcacgtcgcggttcggcgtgacgttcccgcaattcgcgaaaatcgaggtcaac
ggcgagggagccgacccgctgttcacctacctgcagcagcagaagggcttcgagggcttc
gacgacggccacgagttgacgcccattctggaagacctgctgtcgaaggacgaccccgac
tacgccggcaagccggacatcaagtggaacttcacgaagttcctcgtcgaccgcgagggc
aacgtcgtgcgccgtttcgagcccaccgcgtccatccccgatgtcgtggcgcccgccgtg
gaggagctgctgtag

DBGET integrated database retrieval system