KEGG   Eggerthella lenta: Elen_2679Help
Entry
Elen_2679         CDS       T00984                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ele  Eggerthella lenta
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Elen_2679
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Elen_2679
Enzymes [BR:ele01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Elen_2679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3100474..3101028)
Genome map
AA seq 184 aa AA seqDB search
MASSIYDFTVKDQQGNDVSLADYRGRVLLVVNTATECGFTPTYAQLQELYTALHERGLDI
LDFPCDQFGHQAPGTNEEIAQFCTSRFGVTFPQFAKIEVNGEGADPLFTYLQQQKGFEGF
DDGHELTPILEDLLSKDDPDYAGKPDIKWNFTKFLVDREGNVVRRFEPTASIPDVVAPAV
EELL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagcatctatgactttaccgtaaaggatcagcagggcaacgacgtgtcgctc
gccgactaccggggtcgcgtgctgctggtggtgaacaccgccactgagtgcggcttcacg
cccacgtacgcccagctccaggagctgtacaccgcgttgcatgagcgaggcctggacatc
ctcgacttcccgtgcgaccagttcggccaccaggcgcccggcacgaacgaggagatcgcg
cagttctgcacgtcgcggttcggcgtgacgttcccgcaattcgcgaaaatcgaggtcaac
ggcgagggagccgacccgctgttcacctacctgcagcagcagaagggcttcgagggcttc
gacgacggccacgagttgacgcccattctggaagacctgctgtcgaaggacgaccccgac
tacgccggcaagccggacatcaagtggaacttcacgaagttcctcgtcgaccgcgagggc
aacgtcgtgcgccgtttcgagcccaccgcgtccatccccgatgtcgtggcgcccgccgtg
gaggagctgctgtag

DBGET integrated database retrieval system