KEGG   Eggerthella lenta: Elen_2735Help
Entry
Elen_2735         CDS       T00984                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Elen_2735
   01230 Biosynthesis of amino acids
    Elen_2735
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_2735
   00030 Pentose phosphate pathway
    Elen_2735
   00051 Fructose and mannose metabolism
    Elen_2735
   00052 Galactose metabolism
    Elen_2735
  Energy metabolism
   00680 Methane metabolism
    Elen_2735
Enzymes [BR:ele01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Elen_2735
Protein phosphatases and associated proteins [BR:ele01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Elen_2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3170629..3171843
Genome map
AA seq 404 aa AA seqDB search
MSTCLVAQSGGPTAVINASLAGVIRANQLNPLYDRVLGGIHGIEGVLADQLYDLTDLSEH
DLELLRQTPSSALGTCRYKLKRDDEADFRRLADVMDAHDIETMFYIGGNDSMDTVDALAE
WAAENAPSKRFIGIPKTVDNDLVPVDHCPGFPSAAKVACQITHATRLDYDAYTRPEVFVL
EVMGRDAGWLAASCCITGDVDLLVLPEVAFDRDAFLAEVRAKFEATGSCYIVVSEGARYA
DGTYLSAGDTAHDGFAHAVLGGAAQTVKQMIVDTGIVPRGVVQDLSRAARSSNFAQSLVD
VTEAYDLGMSAHMRSADPAFTGQVVGIRRNPEAAAEGRYEAELFAGPASEFANFVKRFPA
EWILPNYQGITPEAVAYFRPLIEGEPKLVMKGGIPATIVPFNKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctgccttgttgcacaatccggcgggcccaccgccgttatcaacgccagcctg
gccggcgtcatccgcgcgaaccagctgaacccgctctacgaccgcgtgctgggcggcatc
cacggcatcgagggcgtgctggccgaccagctgtacgacctcaccgacctttccgagcac
gacctggagctgctgaggcagacgccctcgtcggcgctgggcacgtgccgctacaagctg
aagcgcgacgacgaggccgatttccgccgcctcgccgacgtgatggacgcgcacgacatc
gaaaccatgttctacatcggcggcaacgactccatggacaccgtggacgcgctggccgaa
tgggcggccgagaacgcgccgagcaagcgcttcatcggcattccgaaaaccgtggacaac
gacctggtaccggtggaccactgccccggcttccccagcgcggcgaaggtggcctgccag
atcacgcacgcgacgcgcctcgactacgacgcgtacacgcgccccgaggtgttcgtgctg
gaagtgatggggcgcgacgcgggctggctggcggcgagctgctgcatcaccggcgacgtc
gatttgttggtgctgcccgaggtcgccttcgaccgcgacgcgtttctcgccgaagtgcgc
gcgaagttcgaggcgaccggctcgtgctacatcgtagtgtccgagggtgcgcgctacgcc
gacggcacctacctgtccgccggcgatactgcgcacgacgggttcgcccacgccgtgctg
ggcggggcggcgcaaacggtcaagcaaatgattgtcgacacgggcatcgtgccgcgcggc
gtggtgcaggatttgtcgcgcgcggcgcgctccagcaacttcgcgcagagcctcgtggac
gtgaccgaggcctacgacctgggaatgagcgcccacatgcgcagcgccgaccccgccttc
accggccaggtggtgggcatccgccgcaacccggaggccgcagccgagggccgctacgag
gccgagctgttcgccggtcccgcaagcgagttcgccaatttcgtcaaacgcttccccgcc
gagtggatcctgccgaactaccagggcattacgccggaagcggtcgcgtacttccggccg
ctcatcgaaggcgagccgaaactcgtcatgaagggcggcatccccgccaccatcgtgccg
ttcaacaagcgctga

DBGET integrated database retrieval system