KEGG   Escherichia coli LF82: LF82_1001Help
Entry
LF82_1001         CDS       T00854                                 

Gene name
hisD
Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
elf  Escherichia coli LF82
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:elf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LF82_1001 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    LF82_1001 (hisD)
Enzymes [BR:elf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LF82_1001 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2112058..2113362
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSADEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETARQ
ALSASRLIVTNDLAQCVEISNQYGPEHLIIQTRNARELVDNITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSVLASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgtccggcgatctccgcttctgaaagcattacccgcaccgttaacgatattctc
gataacgtgaaaacgcgtggcgatgaggccctgcgtgaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgctgatgagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccggtggcttcagtgggtttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcaggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttacgcggcgcagctgtgcggcgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccag
gtaagccagcgtctggacggtgcggcaatcgatatgcccgcaggtccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactcacaggtgattttactgacgcccgatgctgatatggcgcgtcgc
gttgccgaggctgtcgaacgccaactggcagaactgccgcgtgccgaaaccgcccgccag
gcactgagcgccagccgcctgatcgtgaccaacgatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgaaacgcccgcgaactggtcgat
aacatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggtgat
tacgcctccggcactaaccacgttctgccgacttacggttacaccgccacctgttccagc
ctcggactggcagatttccagaagcgcatgaccgtgcaggaactgtcgaaagaaggtttt
tccgtgctggcgtcgaccattgaaacactcgccgccgccgagcgcctgactgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggaacaagcatga

DBGET integrated database retrieval system