KEGG   Escherichia coli LF82: LF82_2769Help
Entry
LF82_2769         CDS       T00854                                 

Gene name
ycjM
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
elf  Escherichia coli LF82
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:elf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1383460..1385139
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPKTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPENEILALVEV
LQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELNNKATLRYSVYYKLSHLITLR
RSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITDLHGRDLISE
VDILGNEITLHPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcgact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagt
aatgatttaaagccactacccacatttaatcagttttaccctcaatggctgcaaagaatt
ttttcacatgttcatttattgcctttttatccatggtcatctgatgatggattttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagccatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgccgttgatccg
aaaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagcgacgatcaaattgacctc
aattaccgtagccctgaagtgttgctggcgatggtggatgtattgctgtgctacctggaa
aagggcgcagagtatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgtcgcgccaggcacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgaaggcgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcactttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttccttgcctctcacgatggcatc
gggcttaacccactgcgggggttgttgcccgaaaacgaaatattagcgctggtcgaggtg
ttacagcaggaaggggcattagtaaactggaaaaataatcccgacggtacgcgtagcccc
tatgaaatgaatgtcacctatatggatgcgttgagccgccgtgagtgtagcgacgaagaa
cggtgtgccaggtttattctcgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagcattctggggtcgcgtaatgattacgcaggtgtcgaaaaacttgga
tataatcgtgcgattaaccgtaaaaaatactctagtaaagaaataacgacagaactgaac
aataaagcgacattaaggtattcggtatattataagttgtcgcatttaattacacttcgt
cgcagtcataaagagtttcatccggataataatttcaccatcgatgcgattaattcattt
gtaatgcgaattcaaagaagcaatgcggatggcgattgcctgacgggattgtttaatgtc
agcgaaaatattcagcatataaatattactgacctgcacggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacactgcatccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system