KEGG   Escherichia coli LF82: LF82_2835Help
Entry
LF82_2835         CDS       T00854                                 

Gene name
ydfQ
Definition
lysozyme from lambdoid prophage Qin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elf  Escherichia coli LF82
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1192380..1192913
Genome map
AA seq 177 aa AA seqDB search
MNVKIRYGLSAAVLALIAAGASAPQILDQFLDEKEGNHTKAYRDGSGIWTICRGATVVDG
KPVIPGMKLSKEKCAQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACESIRWWIKDGGRDCRTRSNNCYGQVIRRDQESALACWGIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaaatcagatacggcctgtcggctgctgttctggcgctgattgccgcaggc
gcgtctgctcctcagatacttgaccagtttctggacgaaaaagagggtaaccacacaaag
gcataccgcgatggttccggcatatggaccatttgccggggtgccacggtggtggatggt
aaacctgttattccgggcatgaaactgtcgaaggaaaaatgcgcccaggttaacgccatt
gagcgggataaggcgctggcatgggtggagcgtaatataaaagttccactgaccgagcca
caaaaagcaggtatcgcgtcattttgcccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggcttaatgccggtgatcgtaaaggtgcctgtgagtcgattcgc
tggtggattaaggacggtgggcgtgattgccgcacacgttcaaataactgctacggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggggatagatcagtga

DBGET integrated database retrieval system