KEGG   Escherichia coli LF82: LF82_397Help
Entry
LF82_397          CDS       T00854                                 

Definition
Fels-2 prophage: prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elf  Escherichia coli LF82
Brite
Enzymes [BR:elf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     LF82_397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2751552..2752067)
Genome map
AA seq 171 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDATVSFAFNVGTGNAC
SSTLVKLLNQRRWAEACRQLPRWVYVKGVFNQGLDNRRAREMAWCLKGAGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccggggtttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggttgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattgga
aatacgtcgggcgtcattcccggcaaaacaatcacggaacgacaggcagcagaagggctt
atttccaacgtgctgcgtgtggagcgggcgctggaaaggtgtgtgaagcaacagccgccg
cagaaggtatatgacgctacggtgtcgtttgccttcaacgtgggaacgggcaatgcctgc
agttctacgctggtgaaattgctcaatcagcggcgctgggcagaagcgtgccgacagttg
ccgcgctgggtttatgtgaaaggtgtgtttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgccttaaaggagctggattatga

DBGET integrated database retrieval system