KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0111Help
Entry
ETEC_0111         CDS       T02069                                 

Definition
dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETEC_0111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETEC_0111
   00020 Citrate cycle (TCA cycle)
    ETEC_0111
   00620 Pyruvate metabolism
    ETEC_0111
Enzymes [BR:elh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETEC_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
129122..131002
Genome map
AA seq 626 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKETAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAKQEAAAPAPAAKAE
APAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAY
VKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIP
HVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSED
GQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQ
GGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHR
VIDGADGARFITIINNTLSDIRRLVM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaaacagctccggcagcagcacca
gcggctgcagcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgataaagcttctatggaagttccggctccgtttgctggcaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggcggctaaacaggaagcggctccggcagcggcccct
gcaccagcggctggcgtgaaagaagttaacgttccggatatcggcggtgacgaagttgaa
gtgaccgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgatcacc
gtagaaggcgataaagcttctatggaagtcccggctccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggctcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcgaaacaggaagcggcagcgccggctccggcagcaaaagctgaa
gctccggcagcagcaccggctgcgaaagcggaaggcaaatctgaatttgcagaaaacgac
gcttacgttcacgcgactccgctgatccgccgtctggcacgcgagtttggcgttaacctg
gcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagacgttcaggcttac
gtgaaagaagctatcaaacgtgcagaagcagctccggcggcgactggcggcggtatccca
ggcatgctgccgtggccgaaggtggacttcagcaagtttggtgaaatcgaagaagtggaa
ctgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgggtgatgatcccg
catgttactcacttcgacaaaaccgatatcaccgagctggaagcgttccgtaaacagcag
aacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggttgtcttcatcatg
aaagccgttgctgcagctcttgagcagatgcctcgcttcaacagttcgttgtcggaagac
ggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtggataccccgaac
ggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatcgagctgtctcgc
gagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcgggcgaaatgcag
ggcggttgcttcaccatctccagcatcggcggcctgggtactacccacttcgcgccgatt
gtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatggagccggtgtgg
aatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctccttcgaccaccgc
gtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaacacgctgtctgac
attcgccgtctggtgatgtaa

DBGET integrated database retrieval system