KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0265Help
Entry
ETEC_0265         CDS       T02069                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ETEC_0265
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ETEC_0265
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ETEC_0265
Enzymes [BR:elh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ETEC_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
294829..295932
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgtctgaaccgtgcccatatcgttgaacttgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcgggcgcgatcgccgccggacgtgagcacctg
ggttacccggaactgccagcgaccatcgcctcgaaacaactgctggcggcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcgatttatggcattcacgtcgggcaa
atgctgctgacccgtgctgatatggaagaccgtgaacgcttcctgaacgcccgcgacacc
ctgcgagcgttgctcgataacaatatcgttccggtaatcaatgagaacgatgctgtcgct
acggcagagattaaggtcggcgataacgataacctttctgcgctggcggcgattcttgcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtataccgctgacccgcgc
agcaatccgcaggcagaactgattaaagatgtttacggcattgatgacgcactgcgcgcg
attgccggtgacagcgtttcaggcctcggaactggcggcatgagtaccaaattgcaggcc
gctgacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtcggtacgctgttccatgcccaggcgact
ccgcttgaaaaccgtaaacgctggattttcggtgcgccgccggcgggtgaaatcacggta
gatgaaggggcaactgccgccattctggaacgcggcagctccctgttgccgaaaggcatt
aaaagcgtgactggcaatttctcgcgtggtgaagtcatccgcatttgcaacctcgaaggc
cgcgatatcgcccacggcgtcagtcgttacaacagcgatgcattacgccgtattgccgga
caccactcgcaagaaattgatgcaatactgggatatgaatacggcccggttgccgttcac
cgtgatgacatgattacccgttaa

DBGET integrated database retrieval system