KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0733Help
Entry
ETEC_0733         CDS       T02069                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00020  Citrate cycle (TCA cycle)
elh00190  Oxidative phosphorylation
elh00650  Butanoate metabolism
elh01100  Metabolic pathways
elh01110  Biosynthesis of secondary metabolites
elh01120  Microbial metabolism in diverse environments
elh01130  Biosynthesis of antibiotics
elh01200  Carbon metabolism
Module
elh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
elh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETEC_0733
   00650 Butanoate metabolism
    ETEC_0733
  Energy metabolism
   00190 Oxidative phosphorylation
    ETEC_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CBJ00241
UniProt: E3PHB1
Structure
PDB: 

Jmol
Position
807506..807853
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgct
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system