KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_1364Help
Entry
ETEC_1364         CDS       T02069                                 

Definition
tryptophan biosynthesis protein [includes: indole-3-glycero phosphate synthase; N-(5'-phospho ribosyl)anthranilate isomerase]
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:elh01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:elh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1456948..1458306)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVETRKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEEQLYIDTLREALPAHVAIWKALS
VGETLPAREFQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgcaaa
cagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttttat
gatgcgctacagggtgcgcgcacggcgtttattctggagtgcaagaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccagcacgcattgccgccatttataaacattac
gcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttcctc
cccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgatcct
taccagatctatctggcgcgctattaccaggctgatgcctgcttattaatgctttcagta
ctggatgacgaacaatatcgccagcttgccgccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgtgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgcgag
cttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttgatg
gcccatgacgatttgcacgccgccgtgcgccgggtgttgctgggtgagaataaagtatgt
ggcctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggtggg
ttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagaacagctg
tatatcgatacgctgcgtgaagctctgccagcacatgttgccatctggaaagcattaagc
gtcggtgaaaccctgcccgcccgcgagtttcagcacgttgataaatatgttttagacaac
ggccagggtggaagcgggcaacgttttgactggtcactattaaatggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system