KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_1413Help
Entry
ETEC_1413         CDS       T02069                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:elh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1508735..1510414
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYHQWLQSIFSHVHLLLFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILELVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSKEITRELNDEATLRHAVYHELSRLITLR
RSHNEFHPDNNFTIDTINSSVMRIQRSNADGNCLTGLFNVSKNIQHVNITNLHGRDLISE
VDILGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagc
aatgatttaaaaccattacccacatttaatcagttttaccatcaatggctgcaaagcatt
ttttcacatgttcatttgttgctgttttatccatggtcatctgatgatggcttttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcatccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttgctggcgatggtggatgttttactctgttaccttgcg
aaaggtgctgagtatgtccgcctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgttgcgccaggtacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgcaggcgatgacgaagcacatatggtgtaccagttctcgctgccgcca
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggctaaacccgctacggggcttgttgcctgaaagcgaaatattagagctggtcgaggcg
ttacagcaggaaggtgcattagtaaactggaaaaataatcccgacggtacacgcagtccg
tatgaaataaatgtgacctatatggatgcgttaagccgccgtgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattcttggctcgcgtaatgattacgcaggtgtcgaaaaactcgga
tataaccgtgcgattaaccgtaaaaaatatcacagtaaagagataacccgagaactgaac
gatgaagctacattaaggcatgcggtatatcatgagttgtcgcgtttaattacacttcgt
cgcagccataacgagtttcatccggataataattttaccattgatacgattaattcatcc
gtaatgcgtattcaaagaagtaacgctgatggtaattgtctgactggattgtttaatgtc
agtaaaaatattcagcatgtaaatattactaatctgcatggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system