KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_1640Help
Entry
ETEC_1640         CDS       T02069                                 

Definition
putative short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETEC_1640
   00670 One carbon pool by folate
    ETEC_1640
Enzymes [BR:elh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ETEC_1640
    1.5.1.-  
     ETEC_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1780255..1780977
Genome map
AA seq 240 aa AA seqDB search
MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagcccttgccaatattaattactggcggaggtcgtcgcatcggcctc
gccctcgcatggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacacac
tatccagccattgatggactgattaatgcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggtctgcgt
gctattttgcataacgccagtgcgtggatggcggaaaaaccgggtgcgccactggccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgcgctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcgtatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagttgctttgtcaccggacgcagtttcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system