KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_1800Help
Entry
ETEC_1800         CDS       T02069                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:elh00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1951230..1951871
Genome map
AA seq 213 aa AA seqDB search
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWYQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLHQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtgccggaaggtgacagtacggtggatgtcgctaaccgcctgattgactggtac
cagtcgcgcggtgaagcggttatcgccagtcaggactggcacccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccaggccaactcgacggtttgccacaa
accttctggccagatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
caccaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaacctctctcgatgactggttacgcgat
catgaaatcgatgaattgatcgttatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggttataaggtaaacgtgattaccgatggttgtcgtggc
gtgaatatccagccacaggacagtgcgcacgcgtttatggagatgtcagctgctggggca
acgctatatacgctggcagactgggaagagacacaggggtaa

DBGET integrated database retrieval system