KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_1894Help
Entry
ETEC_1894         CDS       T02069                                 

Definition
holliday junction ATP-dependent DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:elh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ETEC_1894
Enzymes [BR:elh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ETEC_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2045484..2046095)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATNDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggacaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcagctgctg
tacggttttaacaataaacaagagcgcacgttgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggcgctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcgctggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtctgcatggcgatctcttt
acgccagccgccgatctggtgctcacgtcgcctgccagcccggcaaccaacgatgctgaa
caggaagcggttgctgcgctggtggcgctgggctataaaccacaagaagccagccgcatg
gtgagcaaaatcgctcgccctgacgccagcagtgaaacattaattcgcgaagccctacgc
gccgcgttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system