KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_2185Help
Entry
ETEC_2185         CDS       T02069                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00040  Pentose and glucuronate interconversions
elh00052  Galactose metabolism
elh00500  Starch and sucrose metabolism
elh00520  Amino sugar and nucleotide sugar metabolism
elh01100  Metabolic pathways
elh01130  Biosynthesis of antibiotics
Module
elh_M00362  Nucleotide sugar biosynthesis, prokaryotes
elh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETEC_2185
   00052 Galactose metabolism
    ETEC_2185
   00500 Starch and sucrose metabolism
    ETEC_2185
   00520 Amino sugar and nucleotide sugar metabolism
    ETEC_2185
Enzymes [BR:elh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETEC_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: CBJ01688
UniProt: E3PBR8
Position
complement(2347798..2348691)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKHMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLNE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcatccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactgctggcggaagtgcaatctatctgcccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttaggtcattccattttgtgtgcacgacccgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagtgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacatatgccgggtgacctctctgaatactccgtcattcagactaaa
gaaccactggatcgtgaaggtaaagttagccgcattgttgaattcatcgaaaaaccggat
cagccacaaacgctggattcagacatcatggccgtgggccgttatgtgctttctgccgat
atttggccggaacttgaacgcactcagccaggtgcatggggacgtattcagctgactgat
gccattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgaccggcgacagc
tacgactgcggtaaaaaaatgggttatatgcaggcgtttgtgaagtatggactacgcaac
ctcaaagaaggggcgaagttccgtaaagggattgagaagctgttaaacgaataa

DBGET integrated database retrieval system