KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_2185Help
Entry
ETEC_2185         CDS       T02069                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETEC_2185
   00052 Galactose metabolism
    ETEC_2185
   00500 Starch and sucrose metabolism
    ETEC_2185
   00520 Amino sugar and nucleotide sugar metabolism
    ETEC_2185
Enzymes [BR:elh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETEC_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2347798..2348691)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKHMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLNE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcatccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactgctggcggaagtgcaatctatctgcccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttaggtcattccattttgtgtgcacgacccgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagtgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacatatgccgggtgacctctctgaatactccgtcattcagactaaa
gaaccactggatcgtgaaggtaaagttagccgcattgttgaattcatcgaaaaaccggat
cagccacaaacgctggattcagacatcatggccgtgggccgttatgtgctttctgccgat
atttggccggaacttgaacgcactcagccaggtgcatggggacgtattcagctgactgat
gccattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgaccggcgacagc
tacgactgcggtaaaaaaatgggttatatgcaggcgtttgtgaagtatggactacgcaac
ctcaaagaaggggcgaagttccgtaaagggattgagaagctgttaaacgaataa

DBGET integrated database retrieval system