KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_2907Help
Entry
ETEC_2907         CDS       T02069                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:elh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3134764..3136188
Genome map
AA seq 474 aa AA seqDB search
MSVFPESFLWGGALAANQSEGAFREGDKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDEITPNQQGIAFYRSVFEE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGTYPAYSARVFREKGVTINKAPGDDEILK
NTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDEFAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVFVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccagaaagttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggtgacaaaggtctgaccactgtcgatatgatcccacacggcgag
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgagatgacgagttt
tatcccagccatgaggcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaggttttccgtacctcaattgcctggagccgtctctttccgcag
ggcgatgaaatcacgcccaatcagcagggcattgctttttatcgttctgtctttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgccacttcgatgtgccgatgcat
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gccagaacctgctttgaagcatttgatggtctggtgaaatactggctaaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcgggtctggtgtttgaagaaggtgaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagttgcaagccggaagatgtctgggcggcgctggagaaagaccgg
gaaaacctgttttttatcgatgtgcaggcgcggggcacgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcaacaaagcaccgggcgatgatgaaatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaacagcagtgcggcgaacgtggtgaaatcgctgcgtaatccgtatctacag
gtgagcgactggggctggggaattgatccactcggtctgcgtatcaccatgaatatgatg
tacgatcgttatcagaagccgctgtttctggtggaaaacggcctgggcgcaaaagatgaa
tttgctgccaatggcgagattaacgacgactatcgcatcagctacttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagacggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctctacgggtgaaatgagcaaacgctacggctttgtcttt
gttgaccgtgacgacgcaggcaacggtacgctgacgcgcacgcgtaagaaatcattctgg
tggtataaaaaagtgattgccagtaatggggaagatttagagtag

DBGET integrated database retrieval system