KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_3006Help
Entry
ETEC_3006         CDS       T02069                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:elh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3246566..3248392)
Genome map
AA seq 608 aa AA seqDB search
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLEN
NEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVA
RFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYR
FGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLD
LLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaaagcaattactggaagctgtggagcacaaacagctacgcccgctggat
gtgcaatttgccctgaccgtggcgggagatgaacatcctgccgtcaccctcgcggcggca
ctgttaagtcatgatgccggagagggacacgtttgtttgccgctttcacgactggaaaat
aacgaggcgtcgcatccgctgttggcgacctgtgtcagtgaaatcggtgagctacaaaat
tgggaagaatgcttgctggcttctcaagcggtcagcaggggagatgaacccacgccgatg
atcctctgtggcgatcgtctttatttgaatcgcatgtggtgtaacgagcgcacagtggca
cgctttttcaacgaagtgaatcatgccattgaggttgatgaagctctactggcgcaaacc
ctggacaaactttttccagtaagcgatgaaattaactggcaaaaagttgcggcggcagtg
gcgctgacgcggcggatctcggtgatttccggcggccctggcaccggtaaaacgaccacc
gtagcgaagttgctggcagcgttaattcaaatggccgacggcgaacgctgccgtatccgt
ctggctgcaccaacgggtaaagctgccgcgcgcttaaccgaatctctcggcaaggctttg
cgacagttaccgctgaccgatgaacaaaagaaacgcattccggaagatgccagcactttg
caccgattgctgggcgcgcagccgggtagccagcgtttacgtcatcatgccggtaacccg
ctgcatcttgatgtgctggtggtagatgaagcgtcaatgatcgatctgcctatgatgtcg
agactgatcgacgccttgcccgatcatgcgcgagtgatctttctcggcgatcgtgatcaa
ctggcctcggttgaggctggggctgtgctgggcgatatctgcgcttatgccaacgcgggc
tttaccgccgagcgtgccaggcagctaagccgcctgacggggactcacgttccggcagga
accggcacagaagcggcatctttgcgcgacagtctctgcctgctgcaaaaaagctatcgt
ttcggcagcgattctggcattggtcagttagctgcggcgatcaaccgtggtgataaaacg
gcagtgaaaaccgtttttcagcaggattttactgatatcgaaaaacggcttttacagagc
ggcgaagattatattgcgatgcttgaggaagctcttgcgggttacggacgttatctggat
ctgctgcaagcgcgtgccgagccggatttaatcattcaggcgttcaatgagtaccagctt
ttgtgcgccctgcgggaagggccgtttggcgtggctggactgaatgagcgaattgagcag
tttatgcaacagaagcgcaaaattcatcgtcatccgcactctcgttggtacgaaggtcga
ccggtgatgattgcccgtaatgacagcgcgcttgggttgtttaatggcgatatcggtatt
gcgctggatcgcgggcaggggacgcgcgtctggtttgcgatgccggacggcaatattaag
tctgtgcaaccgagtcgcttgccagagcacgaaactacgtgggcgatgacggtacataaa
tcgcagggatcggagttcgaccatgcggcgttgattttgccgagccaacgcacgccggta
gtaacgcgagagctggtttataccgcggtgacccgcgcgcgtcgccgtctgtcgctgtat
gccgatgagcgcatattaagtgcggcaatcgccactcgtactgagcggcgcagtggtctg
gcggcgttgtttagttcacgggaataa

DBGET integrated database retrieval system