KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_3197Help
Entry
ETEC_3197         CDS       T02069                                 

Definition
putative sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETEC_3197
Enzymes [BR:elh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ETEC_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3451650..3452570)
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCKLIVLQLEVQLETVYHAIEFGKKNGIEVLLNPAPALRELDMSYACKCDF
FIPNETELEILTGMSVDTYDHIRLAARSLVDKGLNNIIVTMSEKGALWMTRDQEVHVPAF
KVNAVDTSGAGDAFIGCFSHYYVQSGDVEAALKKAALFAAFSVTGKGTQSSYPSIEQFNE
FLTLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcagttattggttccaatatggtggatctcattacttacactaatcagatg
cctaaagaaggagaaactctggaagcacctgccttcaaaatcggatgtggtgggaaaggt
gctaatcaagcggtggcggcggctaaattgaattcaaaagtcctgatgctgactaaagta
ggtgatgatatttttgcggataatactattcgtaatctcgaatcatggggaattaatacc
acttatgttgagaaagtcccctgtaccagcagtggtgttgcaccgatctttgttaatgcc
aactcgagcaatagtatattaataattaagggagcgaataaatttctttccccggaagat
atcgatcgagctgcagaagatctgaaaaaatgcaaattgatcgttttacaactggaagtt
caactggaaacagtttaccacgcgattgagtttggtaagaaaaatggtattgaagtgtta
ttaaatccggctccggcattgcgtgagttagatatgtcttatgcctgcaaatgtgatttc
tttatcccgaatgaaacagaactggaaatattaaccggtatgtcggttgatacttatgat
catattcgtttggccgcacgttcgttagttgataaagggctgaacaatattattgttacc
atgagcgaaaaaggcgcattatggatgacccgcgatcaggaagtccatgttcctgcattc
aaagtaaatgctgttgatactagtggcgctggtgacgcatttattggttgcttttcccat
tattatgttcaaagcggtgatgttgaagccgctttgaaaaaagccgctctctttgccgct
ttcagcgtcacagggaaaggtacgcaatcatcttatccgagtattgaacaatttaatgaa
tttttaaccttaaacgaataa

DBGET integrated database retrieval system