KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_3889Help
Entry
ETEC_3889         CDS       T02069                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ETEC_3889
Enzymes [BR:elh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ETEC_3889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4200745..4201368
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHD
EFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLK
TIIRAERLRMSRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacacccaggtttctgtttcacacacc
acacgccaaccgcgtcctggtgaagtccacggtgaacattatttctttgttaatcatgat
gaatttaaagaaatgattagcagagatgcgttcctcgaacacgcagaagtttttggtaat
tactatggcacttcgcgtgaggccattgagcaagtactggcgaccggtgtcgatgttttt
ctcgatatcgactggcagggcgcgcagcaaattcgccagaagatgccgcacgcgcggagt
atctttattttaccgccgtccaaaattgaactggaccgccgtctacgcggtcgcggtcag
gacagcgaagaggtcattgcaaagcgtatggcgcaagctgttgcagaaatgagccattac
gccgaatatgattatctgattgtgaatgatgacttcgataccgcgttgaccgatttgaag
accattattcgcgccgaacgtctgcgcatgagccgccaaaagcagcgtcatgacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system