KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_4593Help
Entry
ETEC_4593         CDS       T02069                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ETEC_4593
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETEC_4593
Enzymes [BR:elh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ETEC_4593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4983364..4984299)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKF
DGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQAL
LALVLNRDLVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctatatcagaaacatatcatttccataaacgaccttagtcgcgatgac
cttaatctggtgctggcgacagcggcgaaactgaaagcaaacccgcaaccagagctgttg
aagcacaaagtcattgccagctgtttcttcgaagcctctacccgtacccgcctctctttc
gaaacatctatgcaccgcctgggtgccagcgtggtgggcttctccgacagcgccaataca
tcactgggtaaaaagggcgaaacgctggccgataccatttcggttatcagcacttacgtc
gatgcgatagtgatgcgtcatccgcaggaaggtgcggcgcgcctggccaccgagttttcc
ggcaatgtaccggtactgaatgccggtgatggctccaaccaacatccgacgcaaaccttg
ctggacttattcactattcaggaaacccaggggcgtctggacaatctccacgtcgcaatg
gttggtgacctgaaatatggccgcaccgttcactccctgactcaggcgttagcgaagttc
gacggcaaccgtttttacttcatcgcgccggacgcgctggcaatgccgcaatacattctg
gatatgcttgatgaaaaagggatcgcctggagtctgcacagctctattgaagaagtgatg
gcggaagtagacatcctgtacatgacccgcgtgcaaaaagagcgtctggacccttccgag
tacgccaacgtgaaagcgcagtttgttcttcgcgccagcgatctccacaacgccaaagcc
aatatgaaagtgctgcatccgctgccgcgtgttgatgagattgcgacggatgttgataaa
acgccacacgcctggtacttccagcaggcaggcaatgggattttcgctcgccaggcgtta
ctggcactggttctgaatcgcgatctggtactgtaa

DBGET integrated database retrieval system