KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_p666_0660Help
Entry
ETEC_p666_0660    CDS       T02069                                 

Gene name
eltA
Definition
heat-labile enterotoxin A chain precursor (lt-a, porcine) (ltp-a)
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p666:complement(50594..51370)
Genome map
AA seq 258 aa AA seqDB search
MKNITFIFFILLASPLYANGDKLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLY
DHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLG
VYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGY
RLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLRKYQSKVKRQI
FSDYQSEVDIYNRIRNEL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataactttcattttttttattttattagcatcgccattatatgcaaatggc
gacaaattataccgtgctgactctagacccccagatgaaataaaacgttccggaggtctt
atgcccagagggcataatgagtacttcgatagaggaactcaaatgaatattaatctttat
gatcacgcgagaggaacacaaaccggctttgtcagatatgatgacggatatgtttccact
tctcttagtttgagaagtgctcacttagcaggacagtctatattatcaggatattccact
tactatatatatgttatagcgacagcaccaaatatgtttaatgttaatgatgtattaggc
gtatacagccctcacccatatgaacaggaggtttctgcgttaggtggaataccatattct
cagatatatggatggtatcgtgttaattttggtgtgattgatgaacgattacatcgtaac
agggaatatagagaccggtattacagaaatctgaatatagctccggcagaggatggttac
agattagcaggtttcccaccggatcaccaagcttggagagaagaaccctggattcatcat
gcaccacaaggttgtggaaattcatcaagaacaattacaggtgatacttgtaatgaggag
acccagaatctgagcacaatatatctcaggaaatatcaatcaaaagttaagaggcagata
ttttcagactatcagtcagaggttgacatatataacagaattcggaatgaattatga

DBGET integrated database retrieval system