KEGG   Erythrobacter litoralis HTCC2594: ELI_00285Help
Entry
ELI_00285         CDS       T00315                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ELI_00285
   00630 Glyoxylate and dicarboxylate metabolism
    ELI_00285
   00640 Propanoate metabolism
    ELI_00285
   00650 Butanoate metabolism
    ELI_00285
  Lipid metabolism
   00071 Fatty acid degradation
    ELI_00285
   00072 Synthesis and degradation of ketone bodies
    ELI_00285
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ELI_00285
   00310 Lysine degradation
    ELI_00285
   00380 Tryptophan metabolism
    ELI_00285
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ELI_00285
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ELI_00285
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ELI_00285
Enzymes [BR:eli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ELI_00285
Exosome [BR:eli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ELI_00285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(77403..78968)
Genome map
AA seq 521 aa AA seqDB search
MTIRGESRAMPTNPEHVPVIIGVGQINDRPADPREGLDPVGLMAEALRRADADGGGGWLE
DCQSLGIVGQIAWPQINPVAGKVAEALGIDPAHVEETTPHGDNPIRLLNEAANRIGAGEA
VICAVTGGEALRTAGALAKMKAAEEAANSPEKAKPKEHDALRDASHRRKLGYAQSYGLVV
PVDVYPLYENAFRAAQGQTLTEGQAESGAIWAGFSQVAARTEAAWIREPRQAEEIIEPTA
DNRPIAFPYTKLQVANSAVNQGAGFIVTSLAEARRRGVSEDRLVFVGAGASAFEPDSILA
RDSYTASAGMETSIRKAMELNAVPADDLDHVELYSCFPCVPKMARRTLGWPLEKPMTVFG
GLTFGGGPIGNYMSHAVACMVEKLRGGGTGLLFANGGYATHSHTIVLSAQPIEGVGFPQD
FDYNDAAEKARDDVPPLDKTYSGPATIETYTVHYKRDGSPRVGTVVARTPDGARTLAVVP
PEDAATIALLTDGKVEPVGQKGRIVRAGHGEWDGMGVWNTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcagaggagaaagccgcgcgatgcccaccaatcccgagcatgtccccgtcatc
atcggtgtcggccagatcaacgacaggccggcggacccgcgcgaagggctcgatccggtt
gggttgatggcggaggcgctgagacgcgcggatgcggacgggggcggaggctggctcgag
gattgccagtcgctcggcatagttggccagattgcctggccgcagatcaacccggtcgcg
ggcaaggttgccgaggcattggggatagatccggcgcatgtcgaggaaactactccgcat
ggcgacaacccgatccgcttgctcaacgaagcggccaaccgcatcggcgcgggcgaagcg
gtcatctgcgcggttacgggtggcgaagcactacggacggcgggcgcgctggcgaagatg
aaggcggcagaggaagccgcgaatagtcccgaaaaagctaagccgaaagagcacgacgcg
ctgcgagacgcatctcaccgccgcaagcttggctatgcgcagagctacggcctggtggtg
ccggtagacgtgtatccgctctacgaaaacgctttccgcgcggcgcagggccagacgctg
accgaaggacaggccgaaagcggggcgatctgggccggtttttcgcaagttgctgcgcgg
accgaggctgcgtggattcgcgagccacgccaggcggaagaaatcatcgagccaactgcc
gacaaccgaccgatcgcctttccctacaccaagctgcaggtggccaattccgccgtgaat
cagggtgcgggcttcatcgtcaccagcctggccgaggcgcggcggcgcggagtgtcggaa
gacaggctggtctttgtcggcgcgggggccagcgccttcgagcccgacagcatcctggcg
cgcgacagctacacggcctcggcggggatggagacctcgatccgcaaagccatggaactg
aacgccgtccccgccgacgatctcgaccatgtcgagctatactcctgctttccctgcgtt
cccaagatggcgcggcgcacgcttggctggccgctcgagaagccgatgacggtcttcggc
gggcttaccttcggcggcggaccgatcggcaactacatgagccacgcggttgcctgcatg
gtcgaaaagctgcgcggcggcggcaccggcttgctgttcgccaatggcggttatgccacg
cacagccacaccatcgtgctgagcgcgcagcccatcgagggcgtcggcttcccgcaggat
ttcgactataatgacgcggctgagaaggcgcgcgacgatgtgccgccgctcgacaagacc
tacagcggtccggcgacgatcgaaacctacaccgtccactacaagcgcgacggatcgccg
cgtgtgggcaccgtcgtcgcacgcaccccagacggcgcccgaaccctcgcggtggtaccg
ccggaagacgcggcgacgatcgcgctccttaccgatggaaaagtcgaaccggtcggccaa
aagggccgaatcgttcgcgccggtcatggcgaatgggacggcatgggcgtctggaacacg
gcttaa

DBGET integrated database retrieval system