KEGG   Erythrobacter litoralis: ELI_00535Help
Entry
ELI_00535         CDS       T00315                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eli  Erythrobacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:eli01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eli00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eli00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eli00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eli00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:eli00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(138241..139212)
Genome map
AA seq 323 aa AA seqDB search
MDLVAVDIGGTHARFAIATVAEDGAITLGEPETLHTEDHASFQTAWEDFRDRMGGSLPDA
ISMAVAGPVKTDIIRFTNNPWIIRPPLIAEKLGCGRYTIVNDFEAVAHAAARAPAEQFIH
LAGPEQDLPAKGTISVLGPGTGLGVAHFWRDGDGGYRVQATEGGHGDFAPLDSIEDAILA
RLRKRHMRVSDERVVSGPAIVDIYHTLAAMEGRAVQELDDVEIWTRGTSGDDSLAAAAVD
RFCLALGSVAGDIALIQGASGVVIAGGLGYRIRETLTASGFEDRFRAKGRFAGLMATLPV
KLIVHPQPGLFGAAAAFAREHLS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgtcgccgtcgatatcgggggaacccacgcccgcttcgccattgccactgtc
gcggaggacggcgcgatcacgctcggcgaaccggagacgctccacaccgaagatcacgcc
agcttccagaccgcgtgggaggattttcgcgatcgcatgggcggcagcctgcccgacgcg
atcagcatggccgtcgccgggccggtcaagaccgacatcatccgcttcaccaacaatccc
tggatcatccgtccgccgctgattgccgaaaagctcggttgcgggcgctacaccatcgtc
aacgatttcgaagccgtggcgcatgctgcggcccgcgcaccagcggaacagtttatccat
ctcgcagggccggagcaggacctgcccgctaaaggcaccatcagcgtgcttggccctggc
accggactaggcgtcgctcatttctggcgcgacggagacggcggctaccgcgtgcaggcg
accgagggcgggcatggcgatttcgccccgctcgattccatcgaggatgcgatcctcgcc
cgcctgcgcaagcggcacatgcgcgtgtcggacgaacgcgtagtttcgggaccggccatc
gtcgacatctaccacacgctcgctgccatggagggccgcgcggtgcaggagctcgacgat
gtcgagatctggacccgcggtaccagcggcgacgacagcctcgccgccgccgctgtcgac
cgcttctgtctcgctctcggcagtgtcgcgggcgatatcgcgttgatccaaggcgcgagc
ggcgtcgtgatagcaggtggcctcggctatcgcatccgtgagacactgaccgcttccggt
ttcgaggaccgctttcgcgccaagggacgctttgccggcctgatggcgacgctgccggtc
aagctgatcgtccatccccaacccggcctgttcggcgcggccgcagcctttgcaagggaa
catctatcgtga

DBGET integrated database retrieval system