KEGG   Erythrobacter litoralis: ELI_00535Help
Entry
ELI_00535         CDS       T00315                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eli  Erythrobacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_00535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_00535
   00052 Galactose metabolism
    ELI_00535
   00500 Starch and sucrose metabolism
    ELI_00535
   00520 Amino sugar and nucleotide sugar metabolism
    ELI_00535
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ELI_00535
   00524 Butirosin and neomycin biosynthesis
    ELI_00535
Enzymes [BR:eli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ELI_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(138241..139212)
Genome map
AA seq 323 aa AA seqDB search
MDLVAVDIGGTHARFAIATVAEDGAITLGEPETLHTEDHASFQTAWEDFRDRMGGSLPDA
ISMAVAGPVKTDIIRFTNNPWIIRPPLIAEKLGCGRYTIVNDFEAVAHAAARAPAEQFIH
LAGPEQDLPAKGTISVLGPGTGLGVAHFWRDGDGGYRVQATEGGHGDFAPLDSIEDAILA
RLRKRHMRVSDERVVSGPAIVDIYHTLAAMEGRAVQELDDVEIWTRGTSGDDSLAAAAVD
RFCLALGSVAGDIALIQGASGVVIAGGLGYRIRETLTASGFEDRFRAKGRFAGLMATLPV
KLIVHPQPGLFGAAAAFAREHLS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgtcgccgtcgatatcgggggaacccacgcccgcttcgccattgccactgtc
gcggaggacggcgcgatcacgctcggcgaaccggagacgctccacaccgaagatcacgcc
agcttccagaccgcgtgggaggattttcgcgatcgcatgggcggcagcctgcccgacgcg
atcagcatggccgtcgccgggccggtcaagaccgacatcatccgcttcaccaacaatccc
tggatcatccgtccgccgctgattgccgaaaagctcggttgcgggcgctacaccatcgtc
aacgatttcgaagccgtggcgcatgctgcggcccgcgcaccagcggaacagtttatccat
ctcgcagggccggagcaggacctgcccgctaaaggcaccatcagcgtgcttggccctggc
accggactaggcgtcgctcatttctggcgcgacggagacggcggctaccgcgtgcaggcg
accgagggcgggcatggcgatttcgccccgctcgattccatcgaggatgcgatcctcgcc
cgcctgcgcaagcggcacatgcgcgtgtcggacgaacgcgtagtttcgggaccggccatc
gtcgacatctaccacacgctcgctgccatggagggccgcgcggtgcaggagctcgacgat
gtcgagatctggacccgcggtaccagcggcgacgacagcctcgccgccgccgctgtcgac
cgcttctgtctcgctctcggcagtgtcgcgggcgatatcgcgttgatccaaggcgcgagc
ggcgtcgtgatagcaggtggcctcggctatcgcatccgtgagacactgaccgcttccggt
ttcgaggaccgctttcgcgccaagggacgctttgccggcctgatggcgacgctgccggtc
aagctgatcgtccatccccaacccggcctgttcggcgcggccgcagcctttgcaagggaa
catctatcgtga

DBGET integrated database retrieval system