KEGG   Erythrobacter litoralis: ELI_00900Help
Entry
ELI_00900         CDS       T00315                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eli  Erythrobacter litoralis
Brite
Enzymes [BR:eli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ELI_00900
Secretion system [BR:eli02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ELI_00900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(216346..217215)
Genome map
AA seq 289 aa AA seqDB search
MNFSHHRPGLKARAAHISLAAASAAALLTSGVAVLTAMPAQAAIARDVVQALKLRLPKTP
IDALDCTSLAPWCEVVSGETLFYTDEAARYLFVGRLYDLEERRDVTATRLLELNPDLLAA
GAARAAGRAEASHSEAAPAPAKTKVDLSQLPHEGAIRWGNPKGPRLVVFSDFQCGYCKKL
TGALEQAGVLVEERPISIFGAASRRLSESVLCASDPVAALHAAYTGKHVPRPASCKAIRA
LDANEAFAKANGFAGTPVIVRASDGAVMHGYRDAATLNRFANQRAGAGQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctcccaccaccggccgggcctgaaagcccgcgccgcgcacatatcgcttgcc
gccgccagcgcagccgccctcctcaccagcggcgttgccgtgctgaccgccatgccggcg
caggccgccattgcccgcgatgtcgtccaggcgctcaagctcaggctcccgaaaactccg
atcgacgcgctcgattgcacaagcttagcgccctggtgcgaggtcgtctcgggcgagacg
ctgttctacaccgacgaagccgcgcgctatctcttcgtcggacggctctacgatctcgaa
gagcggcgcgacgtcaccgcgacgcggctcctcgagctcaatcccgacttgctcgccgcc
ggagccgcgcgcgctgcgggccgcgccgaagcctcgcacagcgaagccgcgcccgcaccc
gccaagacaaaggtcgacctctcgcagctccctcatgagggcgcgatccgctggggcaat
cccaaggggccgcggctcgtggtcttctccgatttccagtgcggctactgcaagaagctc
accggcgcactcgagcaggcgggcgtactggtcgaggagcgaccgatctcgatcttcggc
gcggcgagccggcgcctctctgaaagcgtcctgtgcgccagcgatccggtcgcggcgctg
cacgctgcctataccggcaagcacgtgccgcgtcccgccagctgcaaggccatccgcgcg
ctcgacgccaacgaggcctttgccaaggccaatggctttgccgggaccccggtgatcgtg
cgcgcaagcgatggcgcggtgatgcacggctatcgtgatgctgcaacgctcaaccgcttc
gccaaccagcgcgccggagcagggcaatga

DBGET integrated database retrieval system