KEGG   Erythrobacter litoralis: ELI_00960Help
Entry
ELI_00960         CDS       T00315                                 

Definition
alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
eli  Erythrobacter litoralis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eli00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:eli00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:eli02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
226664..228169
Genome map
AA seq 501 aa AA seqDB search
MVSRRALLGRTALALAASRFLSPVTAIAVQPQPYADGDPFMLGVASGDPRPDGFVLWTRP
LGLSGTATVGVEIADDDGFRRIVRSGSVTASPARGHAVHVEPVDLDPARTYFYRFHLDGA
TSPIGRTATIDPQATRMRLALAACQHWEHGWFSAYRDMVAQEINVLLHVGDYIYEKSFGT
GPDVRSFGAPDPFTLDEYRVRHALYRTDPDLQAATAAFPIIATWDDHEVENDYASLQGSV
TEDPAAFVARRAAAYQAWFEHMPISPRRLTPHGAADIVRRFEWGALASLSVLDCRQFRTS
QPCGRGGQVIADCAEVFDPVATMLGLEQEAWLRDRLANERTRWSLIGQATMVSRLPLPGG
GDARWSDIWDGYAASRDRLIAALRQPAVRNAVLLGGDVHSFWANDIPSDPERMEGPVVAS
EIVTSCLASRSGPEELFTGIQGRNPQVRFHDNDNAGYTLLDIDAERIDGRFRAVRDLTDP
NSASFDLRRFAIEDRAPGVRI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgcgtcgcgcattgcttggccggacggcgctggcgctggctgcgtctcgcttc
ctgtctccggtaacggccatcgctgtgcaaccgcaaccatatgccgatggcgatcccttt
atgctcggcgtcgcctcgggcgatccgcgtcctgatgggttcgtgctctggactcggcct
ttgggtctgtcgggcactgctacggtcggtgtggagatcgccgacgacgatggtttccgc
aggatcgtgcgcagtggttcggtcaccgcaagtcctgcgcgcgggcacgcagtgcatgtg
gagccggtcgacctcgatccagcacgcacttatttctaccgttttcacctcgatggagcg
acgagccccatcggtcgcacagccacgatcgatccgcaggccacgcgcatgcgcctcgcg
ctcgcggcctgccagcattgggaacatggctggttttccgcctatcgggacatggtcgcg
caggagatcaatgttctcctgcatgtcggagactacatctacgagaagtctttcgggacc
ggccccgacgttcgcagtttcggcgcgcccgatccgttcacgctggacgagtatcgcgtt
cgtcatgcgctctaccgcaccgatcccgatctgcaggccgccaccgctgccttcccgatc
atcgcgacctgggacgatcacgaggtagagaatgactatgcctcgcttcagggcagcgtc
acagaagaccctgccgctttcgttgcgcgcagggccgctgcctatcaggcatggttcgaa
cacatgccgatatcgccgcgccgcttaacaccgcatggcgcggcggacattgtgcgcaga
ttcgaatggggcgccctagccagcctctcggttctcgactgccgccagttccgcacgtcg
cagccgtgtggacgcggcgggcaggtgatcgcggactgcgcggaggtcttcgatccggtg
gcgaccatgctcgggctcgaacaggaggcgtggttgcgcgatcgcctggcgaacgagcgc
acccgttggagcctgatcggtcaggcgacgatggtctcgcggctgcccttgccgggcgga
ggcgatgcgcgctggtccgatatctgggatggctacgccgcctctcgcgaccgcctgatc
gctgcactgcgccagccggcggtgcgcaatgcggtgctgcttggcggcgacgtccattcc
ttctgggccaacgacatcccatccgatccggagcggatggaagggccggtggtcgcgagc
gagatcgtcacgtcctgtctcgcctcgcgcagcggccccgaagagctcttcacaggcatc
cagggccgcaatccgcaggtccgcttccatgataatgataacgccggatacactctgctc
gacatcgatgctgaacggatcgacggccggtttcgcgcagttcgtgatctgacggatccc
aatagcgccagcttcgatttgcgccggttcgctatcgaggacagggcgcccggggtgaga
atttag

DBGET integrated database retrieval system