KEGG   Erythrobacter litoralis: ELI_01535Help
Entry
ELI_01535         CDS       T00315                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eli  Erythrobacter litoralis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:eli00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
351944..352891
Genome map
AA seq 315 aa AA seqDB search
MTRFDRRAIPSSAKEDWWGLPDGHRVRRIDWASEAEPPRGSILFMPGRGDHYEKYLESLD
EWHRAGWQVTAADWRGQGASGRLGTDEVTGHVDDFAIWIDDLAALWADWKAQTPGPHVLV
AHSMGGHLGLRAVAEERVDPGAVVLSAPMLGFVGNLPVSLTHGVARLMSRVGDPRRPAWK
WSEKPGEIPAGRLKLLTHDDERYQDELWWREKRPELVMGPGSWGWVERAYASMRGLFAEG
VLESVTTPILLLSTSNDKLVSHRKVVDAAERLPNSELLAFGRECHHEILREVDAVRDRAM
EGIANFLDRKAPARD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtttcgatcgccgcgccattccgtcatcagcgaaggaagattggtggggcctg
cccgatgggcacagggtgcgccgtatcgattgggcgagcgaggccgagcctccgcgcggc
tccatcctgttcatgccggggcgcggcgatcactacgagaaatacctcgaaagtctggat
gaatggcatcgcgccggctggcaggtgacggcagccgactggcgcggccaaggtgcctcc
ggacggctcgggaccgacgaggtgactggccatgtcgacgactttgcgatctggatcgac
gatttggcggcgctgtgggccgactggaaagcgcagacgccaggaccgcatgtgctggtc
gcgcattccatgggcggacatctgggcttgcgggcggtggccgaagaacgggtcgatccc
ggcgcggtggtgctttccgcgcccatgctcggctttgtcggcaacctccccgtcagcctg
acgcacggcgtagcgcggctgatgtcccgggtgggcgaccccaggcggccggcgtggaag
tggagcgaaaagcccggagaaattcctgcgggccgcctcaagctcctgacccacgacgac
gagcgctatcaggacgaactatggtggcgtgaaaagcggcccgaactcgtcatgggcccc
ggaagctggggctgggtggagcgcgcttatgcctcgatgcgcggcttgttcgcggaaggc
gtgctcgaaagcgttacgacaccgatcttgctgctgtcgacctcgaacgacaaactcgtg
agccaccgcaaggtggtcgacgctgcggaacgcctgcccaacagcgagctcttggctttc
ggacgcgaatgtcatcacgaaatccttcgcgaagtcgatgccgttcgcgatcgcgcgatg
gagggtatcgccaatttcctcgaccgcaaggcgcccgcgagagactga

DBGET integrated database retrieval system