KEGG   Erythrobacter litoralis: ELI_01535Help
Entry
ELI_01535         CDS       T00315                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eli  Erythrobacter litoralis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ELI_01535
Enzymes [BR:eli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ELI_01535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351944..352891
Genome map
AA seq 315 aa AA seqDB search
MTRFDRRAIPSSAKEDWWGLPDGHRVRRIDWASEAEPPRGSILFMPGRGDHYEKYLESLD
EWHRAGWQVTAADWRGQGASGRLGTDEVTGHVDDFAIWIDDLAALWADWKAQTPGPHVLV
AHSMGGHLGLRAVAEERVDPGAVVLSAPMLGFVGNLPVSLTHGVARLMSRVGDPRRPAWK
WSEKPGEIPAGRLKLLTHDDERYQDELWWREKRPELVMGPGSWGWVERAYASMRGLFAEG
VLESVTTPILLLSTSNDKLVSHRKVVDAAERLPNSELLAFGRECHHEILREVDAVRDRAM
EGIANFLDRKAPARD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtttcgatcgccgcgccattccgtcatcagcgaaggaagattggtggggcctg
cccgatgggcacagggtgcgccgtatcgattgggcgagcgaggccgagcctccgcgcggc
tccatcctgttcatgccggggcgcggcgatcactacgagaaatacctcgaaagtctggat
gaatggcatcgcgccggctggcaggtgacggcagccgactggcgcggccaaggtgcctcc
ggacggctcgggaccgacgaggtgactggccatgtcgacgactttgcgatctggatcgac
gatttggcggcgctgtgggccgactggaaagcgcagacgccaggaccgcatgtgctggtc
gcgcattccatgggcggacatctgggcttgcgggcggtggccgaagaacgggtcgatccc
ggcgcggtggtgctttccgcgcccatgctcggctttgtcggcaacctccccgtcagcctg
acgcacggcgtagcgcggctgatgtcccgggtgggcgaccccaggcggccggcgtggaag
tggagcgaaaagcccggagaaattcctgcgggccgcctcaagctcctgacccacgacgac
gagcgctatcaggacgaactatggtggcgtgaaaagcggcccgaactcgtcatgggcccc
ggaagctggggctgggtggagcgcgcttatgcctcgatgcgcggcttgttcgcggaaggc
gtgctcgaaagcgttacgacaccgatcttgctgctgtcgacctcgaacgacaaactcgtg
agccaccgcaaggtggtcgacgctgcggaacgcctgcccaacagcgagctcttggctttc
ggacgcgaatgtcatcacgaaatccttcgcgaagtcgatgccgttcgcgatcgcgcgatg
gagggtatcgccaatttcctcgaccgcaaggcgcccgcgagagactga

DBGET integrated database retrieval system