KEGG   Erythrobacter litoralis: ELI_01770Help
Entry
ELI_01770         CDS       T00315                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eli  Erythrobacter litoralis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eli00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eli00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
396388..397875
Genome map
AA seq 495 aa AA seqDB search
MKLARLAEAAGIAIEGGEDIAVSGFAIDHRKVAPGTVFGAFQGSAVNGEDYISQAVAAGA
VAVVAQPEATVEGAVHIAEDTPRRAFALLAAQYFTPVPKTIVAVTGTNGKTSTVEMTRQL
WRMAGERAASIGTLGVTTPDESVSTGLTTPDIVTFLSNMSGLAREGVTHVAYEASSHGLS
QYRNEGLPVAAAAFTNFSRDHLDYHGTMDEYFEAKMRLFDEVVDAGGTAVVWTGNSEWTA
QAIERARQRELRLFTVGEQGEDIRLRARTPTQLGQELEIEHAGETRKLRLPLIGEYQVAN
ALTAAGLAIATGTDPAAVWDGVSRLQPVRGRLERAVITATGAPVYVDYAHTPDALEAALA
ALRPHVEGRLLCIFGAGGDRDTGKRAPMGEVASRMADAVIVTDDNPRGEDPAAIRGQVLE
GAGDNAREMADRREAIREVIESAAAKDIVLIAGKGHETGQIIGSGENMRVEPFDDVQVAR
ECAAQISKNAWGATE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcttgcccggctggcagaagcggcaggcattgccatcgaaggcggcgaggacatc
gccgtctcgggttttgccatcgaccatcgcaaggtcgcgccgggcaccgtcttcggtgcc
tttcagggctccgccgtcaacggagaggactatatttcgcaggccgtcgccgccggggcg
gtcgccgtggtagcgcagcccgaggccacggtcgaaggcgcggtccacatcgccgaggat
acgccgcgccgcgcctttgccctgctggcggcgcagtatttcaccccggtgccgaaaacg
atcgtcgcggtcacagggaccaatggcaagacctcgaccgtcgagatgacccgccagctt
tggcgcatggcgggcgagcgcgccgccagtatcggcacgcttggcgtgacgacgccggac
gagagtgtttcgaccggtttgacgacgcccgacatcgtcactttcctcagcaatatgagc
gggctcgcgcgcgaaggcgtgacccatgttgcctacgaggcttcgagccacggcctttcg
caatatcgcaacgagggtctgcccgtcgcagcagcggccttcaccaatttcagccgcgat
catctcgattatcacggcacgatggacgaatatttcgaggccaagatgcgcctgttcgac
gaagtcgtcgatgcaggcgggacggccgtggtctggacgggcaatagcgagtggaccgcc
caggccatcgagcgggcgcgccagcgagaactgcgcctgttcacggtgggcgagcagggt
gaggacatccgcctgcgcgcccgtacccccacccaattggggcaggaactcgagatcgaa
catgctggcgagacgcgcaagctgcggctgccgctgatcggtgagtaccaggtcgccaac
gcgctgaccgccgccggcctcgccatcgcaacgggcaccgaccccgccgcagtctgggat
ggcgtcagtcggctgcagccggtgcgcggacgcttggagcgcgcggtcatcacggcaaca
ggcgcgcctgtctacgtcgactatgctcacacacctgacgcgctcgaagcggcgctggcg
gcgctgcgcccgcatgtcgaagggaggctgctgtgcattttcggtgccggcggcgaccgc
gatacaggcaagcgcgcgccgatgggcgaagtcgcttcgcgcatggcggatgccgtgatc
gtcaccgacgacaatccgcgcggcgaagaccctgcggcgatccgtgggcaggtgcttgaa
ggcgcaggcgacaatgcgcgagaaatggcggaccggcgcgaggctatccgcgaggtcatc
gaatcagccgcggcgaaggacatcgtcctgatcgccggcaagggacacgaaaccggacaa
atcatcgggtcgggagagaatatgcgggtcgaaccgtttgacgacgtacaggtcgcacgc
gaatgcgcggcgcagatttcgaaaaatgcctggggcgcaaccgaatga

DBGET integrated database retrieval system