KEGG   Erythrobacter litoralis: ELI_02075Help
Entry
ELI_02075         CDS       T00315                                 

Definition
(GenBank) recombinational DNA repair protein
  KO
K06187  
recombination protein RecR
Organism
eli  Erythrobacter litoralis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ELI_02075
DNA repair and recombination proteins [BR:eli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ELI_02075
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ELI_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
459238..459834
Genome map
AA seq 198 aa AA seqDB search
MASQEIEQLASTLARLPGLGPRSARRAVLWLVKKRDTALPALLEALEGVQDRLVECDTCG
NVDTQNPCGICADPRRDRKSICVVEDVADLWALDRARLFTGRYHVLGGKLSALDGVRPED
LNIANLLGRVEEGGIDEVVLAMNATLEGQTTSHYIAERLEEFPVRITQLAHGLPVGGELD
YLDEGTLAQALRARRPVQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcaagagatcgaacagctcgcttccacgctggcccggctgcccggcctcggt
ccgcgctcggcgcggcgggcggtgctgtggctggtcaagaagcgcgacaccgcactgcct
gcgttgctcgaagcgctggaaggcgtgcaggaccggctggtcgaatgcgacacctgcggc
aatgtcgatacgcagaacccctgcggcatctgtgccgatccgcgccgcgaccggaaatcg
atctgcgtggtcgaggacgtcgccgacctgtgggcgctcgaccgcgcgaggctcttcacc
gggcgctaccacgtgctgggcggcaagctctccgcgctcgacggcgtgcgccccgaagat
ctcaatatcgcaaatcttcttggcagggtcgaggaaggcggcatcgacgaggtcgtgttg
gcgatgaatgccacgctcgaaggtcagacgaccagccattatatcgccgagcggctggaa
gagtttcccgtgcggatcacccagctggcccatggcctgccggtcggcggcgagctggat
tacctggatgagggtacgctggcgcaagcgctcagggcacgtcgtcctgtccagtaa

DBGET integrated database retrieval system