KEGG   Erythrobacter litoralis: ELI_02305Help
Entry
ELI_02305         CDS       T00315                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eli  Erythrobacter litoralis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ELI_02305
Enzymes [BR:eli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ELI_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501668..502792
Genome map
AA seq 374 aa AA seqDB search
MTETVYIRPIGFVPGPQAEEGDAIRLAGSMVYAHRFAVILRRDGQVAERWTCSPEHIAQV
LGELPDSVGAEAETQWANLTITHPPLSLGERTVRLDQPQVMGILNVTPDSFSDGGKFLGA
DGSWPEAGKAQAAAMLEAGASIIDIGGESTRPGAEVVIEDHEIERVLPAVEYCAAMGAAI
SVDTRRAGVMAAALDAGASIVNDVSGLQYDPRSAELVAARGCPVILMHAPGSGQDLHEGG
DYESVVFDVFDQLKARRDTAVAAGISADRIMLDPGLGFGKKLSDNTALINALPLFHALGH
PILLGASRKRMIGALSNEAPVEQRLGGSIALAVAGMDAGAHMLRVHDVAETVQARNVWRG
LRDAALTDFSDLAM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccgtctacatccgccccatcggctttgtgccgggtccgcaggcggaggag
ggggatgcgatccggttggcggggagcatggtctatgcgcatcgctttgcggtgatcctg
cgccgggatggccaagtggcggagcgttggacctgctcgcccgagcatatcgcgcaggtg
ctgggcgagctgcccgacagcgtcggggcggaggcggagacgcagtgggccaatctcacc
atcacgcatccgccgctgtcgctgggcgagcgcacggtgcggctcgaccagccgcaggtg
atgggcatcctcaatgtcacgcccgacagtttttccgacggcggcaagttcctcggtgct
gatggttcttggcccgaagccggcaaggcgcaggctgcggcgatgctggaggcgggcgcg
tcgatcatcgacatcggcggcgagagcacgcggcccggtgccgaggtggtgatcgaagac
cacgagatcgaacgcgtgctgcccgcagtcgaatattgcgccgcgatgggcgcggcgatc
agcgtggacacccgccgcgccggggtgatggcggcggcgctcgatgcgggggcgagcatc
gtcaacgatgtttcgggcctgcaatatgatccgcgcagcgccgaactggtcgccgcacgc
gggtgcccggtgatcctgatgcatgcgccgggaagcgggcaggacctgcatgaaggcggg
gactacgaaagcgtagtgttcgacgtgttcgaccagctcaaggcgcggcgcgatacggcg
gtggcggcggggatttcggcggataggatcatgctcgatcccgggctgggcttcggcaag
aagctgtcggacaacaccgcgctgatcaacgcgctgccgctgttccacgcactcggccac
ccgatcctgctcggcgcgagccgcaagaggatgatcggggcgctgagcaacgaagcgccg
gtcgagcagcggcttggcggttctatcgcgctggcggtggcggggatggatgccggggcg
catatgctgcgggtccacgatgtcgcggagacggtgcaggcgcgcaatgtgtggcgcggc
ctgcgggatgcggcgctgaccgactttagcgacctggcgatgtga

DBGET integrated database retrieval system