KEGG   Erythrobacter litoralis HTCC2594: ELI_02760Help
Entry
ELI_02760         CDS       T00315                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00260  Glycine, serine and threonine metabolism
eli00750  Vitamin B6 metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01230  Biosynthesis of amino acids
Module
eli_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_02760
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ELI_02760
Enzymes [BR:eli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ELI_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABC62644
UniProt: Q2NCE7
Position
587821..589224
Genome map
AA seq 467 aa AA seqDB search
MRYISTRGSAPTLSFEEVTLTGLASDGGLYLPQGWPSFSADDIRAMRGQPYAEIAARVMA
PFVGDSLSFEELRGLTEEAYGRFSHAAVVPLVQLDHQHWLMELFHGPTLAFKDVALQMLG
LLFETFLARRGEQLTLVGATSGDTGSAAIDAVAGRDGVEIFMLHPQGRISDVQRRQMTTV
RAPNIHNIAISGSFDDGQAAVKRMFTDTEIAGKIRLGAVNSINWARLMAQVVYYFTTAVQ
LGAPERSVAFSVPTGNFGDVFAGYVASKMGLPVEQLIVATNVNDILHRALSDGDYSAGTV
TPTAAPSMDIQVSSNFERLLFDVGGRDGAVMAEQMRGFETSKAMQLTNSQREGAATRFTS
VRVDQDAMAHSMRRAFENSGEVIDPHTAIGLYAAYQADIAPDVPIVTLATAHPAKFRDAV
ERATGTRPPLPTRVGDLFAREEACTELSGDYDELTDFILTNAAQAHG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatctccacccgtggctctgcgcccacgctctctttcgaagaggtcacgctg
accggcctcgccagcgatggcgggctgtatctgccgcagggatggccgagctttagtgcc
gacgacatccgcgcaatgcggggccagccctatgccgagatcgccgcgcgggtgatggct
ccctttgtcggcgacagcctgagtttcgaggaactgcgggggctgaccgaggaggcctat
gggcgcttctcccatgccgcggtggtgccgctggtccagctcgatcaccagcattggctg
atggagctgttccacgggccgacgctcgcgttcaaggacgtggcactgcagatgctcggc
ctgctgttcgagaccttcctcgcccggcgcggcgagcagctcacgctcgtcggcgcgacc
agcggcgatacaggcagcgcagctatcgatgcggtggctgggcgcgacggggtcgagatc
ttcatgctccatccgcaaggccggatcagcgacgtccagcgccgccagatgactacggtg
cgcgcgccgaatatccacaatatcgccatctccggcagtttcgacgacggccaagcggct
gtgaagcggatgttcaccgatactgaaattgcggggaagatccgcctcggcgcggtcaat
tcgatcaactgggcgcggctgatggcgcaagtggtctattacttcaccaccgccgtgcag
ctgggcgcgcccgagcgcagcgtggccttcagcgtcccgacgggaaatttcggcgatgtc
tttgcaggctatgtcgcgagcaagatgggcctacccgtcgagcaattgatcgttgctacc
aatgtgaacgacatccttcatcgcgccttatccgacggcgattattcggcgggcactgtc
acacccaccgccgcgccgagcatggatatccaggtcagctctaatttcgagcgcttgctg
ttcgatgtcggcgggcgcgatggcgccgtcatggcagagcagatgcgcggcttcgaaacg
tcgaaagcgatgcagctcaccaattcgcagcgcgaaggcgcggccacgcgtttcaccagc
gtgcgcgtggaccaggatgcgatggcgcattcgatgcggcgcgccttcgagaattcgggc
gaagtgatcgacccgcatacagcgatcgggctttatgccgcttatcaggctgacatcgcg
cccgacgtaccgatcgtcacgctcgctaccgcgcatccggccaagttccgcgatgcggtc
gagcgcgcgacgggcacgcgaccgccgcttcccacgcgggtcggcgacctgttcgcgcgc
gaagaagcctgcaccgaactgtctggcgattatgacgagctaacggacttcatcctcacc
aatgccgcgcaggctcatggctga

DBGET integrated database retrieval system