KEGG   Erythrobacter litoralis HTCC2594: ELI_03470Help
Entry
ELI_03470         CDS       T00315                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase superfamily protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00071  Fatty acid degradation
eli00280  Valine, leucine and isoleucine degradation
eli00310  Lysine degradation
eli00360  Phenylalanine metabolism
eli00362  Benzoate degradation
eli00380  Tryptophan metabolism
eli00410  beta-Alanine metabolism
eli00627  Aminobenzoate degradation
eli00640  Propanoate metabolism
eli00650  Butanoate metabolism
eli00903  Limonene and pinene degradation
eli00930  Caprolactam degradation
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ELI_03470
   00650 Butanoate metabolism
    ELI_03470
  Lipid metabolism
   00071 Fatty acid degradation
    ELI_03470
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ELI_03470
   00310 Lysine degradation
    ELI_03470
   00360 Phenylalanine metabolism
    ELI_03470
   00380 Tryptophan metabolism
    ELI_03470
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ELI_03470
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ELI_03470
   00281 Geraniol degradation
    ELI_03470
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ELI_03470
   00627 Aminobenzoate degradation
    ELI_03470
   00930 Caprolactam degradation
    ELI_03470
Enzymes [BR:eli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ELI_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SeleniumBinding
Motif
Other DBs
NCBI-ProteinID: ABC62786
UniProt: Q2NC05
Position
716260..717093
Genome map
AA seq 277 aa AA seqDB search
MTDQRVRTDNPANGVARLTLTRADKANAQDKAMLYQLDDALTAAAQNDDVRCIVLAAEGE
HFSSGHDLRDDSSLADFEPRSQWSGFDASGQEGQMAAEHEIYLGLCWRWRNLPKPVVVQV
QGLCMAGGLMLVWPFDIVIASEDAVFSDPTVAFGVNGVEYFAHVWELGHRKARELLYTGA
DLSAEDARTLGMVNHVVPRDELDSFTLTMAERIAKRPMIGLRLAKLACNQSLDAQGYGTA
IHGVMGWQQVGHAQARLVHGLPVDPAGAEIIRSDRKR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcaacgcgtccgaaccgataatcccgcaaatggcgtcgcccgcctcaccctg
acgcgcgccgacaaggccaatgcgcaggacaaggcgatgctgtaccagctcgacgatgcg
ctgaccgcagcggcgcagaatgacgatgtgcgctgcatcgtcctggcggcggaaggcgag
cacttctcctccggtcacgacctgcgcgacgacagctcgctcgcagacttcgaaccgcgc
agccagtggagcggcttcgatgcatcggggcaggaaggccagatggccgccgagcacgag
atctatctcggcctgtgctggcgctggcgcaacctgcccaagccggtggtggtgcaggtg
cagggcctgtgcatggcaggcgggctgatgctggtctggcccttcgacatcgtgatcgcg
agcgaggatgcggtgttctccgatccgacggtggcgttcggcgtcaacggggtcgaatat
ttcgcgcatgtctgggagctcggccaccgcaaggcgcgcgaactgctctacaccggcgcg
gacctgagcgccgaggatgcgcggacgcttggcatggtcaaccacgtcgtgccgcgcgac
gagttggatagctttacactgacgatggccgagcggatcgcgaagcgtccgatgatcggg
ctgcggctggccaagctggcctgcaaccagagcctcgatgcgcagggctatgggacggct
atccatggcgtgatgggttggcagcaggtcggccacgcgcaggcgcggctggtgcacggg
ttgccggtcgatccggcgggcgcggagattatccgctcggatcgcaagcgatag

DBGET integrated database retrieval system