KEGG   Erythrobacter litoralis HTCC2594: ELI_03805Help
Entry
ELI_03805         CDS       T00315                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00900  Terpenoid backbone biosynthesis
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ELI_03805
Enzymes [BR:eli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ELI_03805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: ABC62853
UniProt: Q2NBT8
Position
787072..788226
Genome map
AA seq 384 aa AA seqDB search
MRSITILGATGSVGASTLDLIRREREVWRVEALTANCSAKELAALAREFDAKVAVVGDEG
CLADLREALSGSGIEAAGGRSALCEAAARPVDITVAAIVGCAGLGPVMAAIEQGGTIALA
NKEALVSAGDVMTAAVAKHGATLLPVDSEHNAIFQCLQGNTIEEVRWITLTASGGPLRTL
SADELHAVTPAQAVAHPNWDMGAKISVDSATMMNKGLEFIEAHHLFPVGLDRIRIVVHPQ
SVIHSMVEYRDGSTLAQLGPSDMKVPIASCLAWPRRMETGCEPLDLVAQGELTFFAPDEE
RFPATRLAREAAEAGGSAPAVLNAANEIAVAAFLDGQIPFTRIALSVEDTLAQSDLPPAP
TSLDDVLAVDSAARERARALLEIA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgattaccatccttggcgctacgggctcggtcggggcttcgacgctcgacctg
atccgccgcgagcgcgaggtgtggcgcgtcgaagcgctgaccgccaattgcagcgcgaag
gagcttgccgcgctggcgcgcgaattcgatgccaaggttgcagtagtgggcgacgagggg
tgcctcgccgacctgcgcgaggcgctgtcgggtagcgggatcgaagcggctggtggccgc
tcggctttgtgcgaagcggcggcgcgtccggtcgatatcaccgtcgcggcgatcgtcggc
tgcgcggggctcggcccggtcatggcggcgatcgagcagggcggcaccatcgcgcttgcc
aacaaggaagcgctggtttccgcgggcgacgtcatgacggcggcggtcgcgaagcacggc
gcgacgttgctgccggtcgacagcgagcacaacgcaatcttccagtgcctgcagggcaac
actatcgaggaagtgcgctggatcacgctgaccgccagcgggggcccgctgcgcacgctc
tcggcagacgagcttcacgccgtcacacccgcgcaagccgtggcgcatcccaattgggac
atgggtgccaagatcagcgtcgattcagccacgatgatgaacaagggccttgagttcatc
gaggcgcaccacctgttcccggtcgggctcgacaggatccggatcgtcgttcatccgcaa
agcgtgatccattccatggtcgaatatcgcgacggctcgaccctcgcgcagctcgggcca
tcggacatgaaagtgccgatcgcctcgtgcctcgcctggccgcggcggatggaaacgggc
tgcgaaccgctcgacctagtggcacagggcgagctgacctttttcgctcccgacgaggag
cgcttcccggccacgcggctggcgcgcgaggcggcggaggcgggcgggtcggccccggcg
gtgctgaatgccgccaacgagatcgcggtcgccgccttcctcgacggtcagataccgttc
acgcgcattgccctatcggtcgaggacaccctcgcgcaatccgacctgccaccggcaccg
acttcgctcgacgacgttcttgcggtagacagtgccgcacgagagcgggcccgcgccctt
ctggagatcgcctga

DBGET integrated database retrieval system