KEGG   Erythrobacter litoralis: ELI_04840Help
Entry
ELI_04840         CDS       T00315                                 

Definition
ribonuclease III
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
eli  Erythrobacter litoralis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(998612..999283)
Genome map
AA seq 223 aa AA seqDB search
MTILAPETLQWLADTGFAVEDDELWLEALTHGSTGAERDYQRLEFLGDRVLGLAISDHLF
RKVGGSEGALAQRLNALVSKGACAKIGRRIGLSDHLVLGKQAREDGAAQSTNILGDVVEA
LLGANYLDAGFGPTCALVHLLWDEDLNGMAGRSKHPKSALQEWAAGNQRRPPQYELVDRS
GPDHAAIFTVRVEVHKVGAAEATASSKQEAETEAAKKFMEQFG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctcgcacccgaaaccctgcaatggctcgccgataccggtttcgcggtggaa
gacgacgagctgtggctggaagccttgacgcacggcagcaccggggccgagcgggactac
cagcggctcgaattcctcggcgaccgggtgctggggctggcgatctccgaccaccttttt
cgcaaggtcggcggatcggaaggcgcactggcgcagcgcctgaacgcgctcgtcagcaag
ggcgcctgcgccaagatcgggcgacggatcgggctgagcgaccacctggtgctcggcaag
caggcgcgcgaggatggggcggcgcagagcaccaacattctcggagacgtggtcgaggcg
ctgctcggcgcgaattatctcgatgccggtttcgggccgacctgcgcgctggtccacctc
ctgtgggacgaggatctgaacggcatggcgggccgctcgaaacatcccaagtcggcgctg
caggaatgggccgcgggcaaccagcggcggcccccgcaatacgagctggtcgaccgttcc
ggccccgatcacgcagcgatattcaccgtgcgggtcgaggtccacaaggtcggcgcggcg
gaagcgaccgccagcagcaagcaggaagccgagaccgaggcagcgaagaaattcatggag
cagttcgggtga

DBGET integrated database retrieval system