KEGG   Erythrobacter litoralis: ELI_05020Help
Entry
ELI_05020         CDS       T00315                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eli  Erythrobacter litoralis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eli00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1031112..1031723
Genome map
AA seq 203 aa AA seqDB search
MACEADYVEDPAIKKPDVPEHVQDAIRTLIEWSGDDPAREGLLDTPKRVGRAWLEYCQGY
KEDPAIHLSRVFEEVGGYDEIVLLKDIPFQSHCEHHMAPITGKAAIAYLPRDKVVGISKL
ARVLHGFARRLQIQERLTAEVANCIWDNLEPEGVAVVIEAQHGCMTGRGVRTPGVSMVTS
KLCGCFLDDERSRKEVLSLMGYG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcgaagccgactatgtcgaagatcccgcgatcaagaagccggacgtgcccgag
cacgtgcaagatgccatccgcacattgatcgaatggtcgggcgacgatccggcacgcgaa
ggtctgctggacactcccaagcgggtcgggcgtgcctggctcgaatattgccagggttac
aaagaggatcctgcgatccacctcagccgggtattcgaggaggttgggggctatgacgag
atcgtcttgctcaaagacatccccttccagagccattgcgagcatcacatggcgccgatc
accggaaaggcggcgattgcctaccttcccagagacaaggtcgtcggtatctccaagctc
gcccgcgtactccacggctttgcccgccggctgcaaatccaggaacgtctgacggccgaa
gtcgcgaactgcatctgggacaatctcgagccagagggcgttgcagtcgtgatcgaagcc
cagcatggctgcatgaccggtcgcggtgtacgaacgcccggggtcagcatggtcacatca
aagctgtgcggctgtttcctcgatgacgaacggagccgcaaggaagtcctcagcctgatg
ggttacggttga

DBGET integrated database retrieval system